PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G29600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 305aa    MW: 32113.6 Da    PI: 7.8175
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G29600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof80.22.3e-255898242
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtk 42
                     +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtk
  OBART02G29600.1 58 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTK 98
                     7899************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-215799IPR003851Zinc finger, Dof-type
PfamPF027012.2E-215999IPR003851Zinc finger, Dof-type
PROSITE profilePS5088419.59162116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAGASPMHIC MDSDWLKGIV PEEHGMGSSS PSAELIACPR APMQAAAAAA DRRLRPQHDQ  60
PLKCPRCEST HTKFCYYNNY SLSQPRYFCK TCRRYWTKAP QRPRRRRHAQ EVLVFVVVVF  120
LPAVAVAAAL QGRHMETGLH LSFSGMQHHL APPPPPAATA ADPLCSLGLF DWKQYDPVFA  180
GSGGGGSPVA ALESAGVSEA QFMGAGMMGI GGGGGGVAEY HALSALRYAA GLGDHLALPF  240
GAGRAEHDAV EVKPVAAERL LSLEWCGEAS RTAAPESSIS SLGGLGLWSG MIGGGHHHHG  300
SSAAI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623280.11e-154dof zinc finger protein DOF3.1
TrEMBLA0A0D3F9H80.0A0A0D3F9H8_9ORYZ; Uncharacterized protein
STRINGOBART02G29600.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-25Dof family protein