PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G28890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 204aa    MW: 22226.6 Da    PI: 4.619
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G28890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.64.2e-1648772655
          G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OBART02G28890.1 48 GATPKSVLELMDVKDLTLAHVKSHLQMYRT 77
                     69***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-144577IPR009057Homeodomain-like
SuperFamilySSF466891.33E-54878IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-114978IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPAT KSMDLGFWKR ALETSTTTTT AAAAASTGAT PKSVLELMDV  60
KDLTLAHVKS HLQMYRTIKT TDHKQPAPPY GQTKTIIEIP DDNLFDINNT SGSESSVQQQ  120
SNLDGNEQGS SMCALRSNNS SSRGAWFHDK SRDATPGDIK SFEDVQSQSP EDDDASDLNS  180
PPFQIPETTV SAMKPNLDFT LGRM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0058594e-78AP005859.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1053A04.
GenBankAP0058684e-78AP005868.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0666E12.
GenBankAP0149584e-78AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015689061.12e-99PREDICTED: probable transcription factor KAN2
TrEMBLA0A0D3F9951e-149A0A0D3F995_9ORYZ; Uncharacterized protein
STRINGOBART02G28890.11e-150(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.15e-17G2-like family protein