PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G25970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 546aa    MW: 59340.5 Da    PI: 4.9016
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G25970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.83.5e-2919103187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW+++e+laLi++r+em+ ++r++ lk+p Wee s++++e g++rs k+Ckek+en+ k+yk++keg+ +r++++s  +++f+qlea
  OBART02G25970.1  19 RWPREETLALIRIRSEMDVAFRNATLKAPVWEELSRRLAELGYQRSGKKCKEKFENVDKYYKRTKEGRTGRQDGKS--YRFFSQLEA 103
                      8*********************************************************************866665..*******85 PP

2trihelix108.35.2e-34313398187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW+k+ev+aLi++r e+ee++++   k+plWee+++ m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  OBART02G25970.1 313 RWPKEEVQALIDLRMEKEEQYNDMGPKGPLWEEIAAGMQRIGYNRSAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 398
                      8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.111678IPR001005SANT/Myb domain
PROSITE profilePS500907.0851876IPR017877Myb-like domain
CDDcd122031.86E-261883No hitNo description
PfamPF138377.0E-2118104No hitNo description
SMARTSM007171.0E-5310372IPR001005SANT/Myb domain
SuperFamilySSF466897.74E-5312380IPR009057Homeodomain-like
PROSITE profilePS500907.851312370IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.1E-5312369IPR009057Homeodomain-like
CDDcd122032.52E-26312377No hitNo description
PfamPF138372.0E-22313399No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MQHPQGAGDL GGSGSTGNRW PREETLALIR IRSEMDVAFR NATLKAPVWE ELSRRLAELG  60
YQRSGKKCKE KFENVDKYYK RTKEGRTGRQ DGKSYRFFSQ LEALHAAAPP PPPQQRQGMP  120
VDGPAAAGDG EDDVARAADL GFLSMSSESE SDDESDEEEE EEEEAVAPGG GGGSSTRKLM  180
AMFEGMMRQV TEKQDAMQRV FLETLEKWEA ERTEREEAWR RKEVARINRE REQLSKERAA  240
AASRDAALIA FLQRVGGAGG EPVRLSPSSA GATRHDAAAA GLQLVPVPAP RAKAEDAWAA  300
AGGDGSGTTA PSRWPKEEVQ ALIDLRMEKE EQYNDMGPKG PLWEEIAAGM QRIGYNRSAK  360
RCKEKWENIN KYFKKVKESN KRRPEDSKTC PYFHQLDAIY RKKHFAGRGG GGGGVTIAAS  420
HSSLAIVTVS EQDNPSQREL EGKSSNDVGN VQLAVPLLVH NAPDKKVEGS EGEPNVTAAA  480
EETDSDEMGG EYTDDGDDDD KMQYKIEFQK PTAGGGGDGN DAAVPATTAA ATSSAPTSNT  540
SFLAVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117420.0AK111742.1 Oryza sativa Japonica Group cDNA clone:J023050K14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622654.10.0PREDICTED: trihelix transcription factor GTL1
SwissprotQ391171e-69TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D3F8820.0A0A0D3F882_9ORYZ; Uncharacterized protein
STRINGORGLA02G0222200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-46Trihelix family protein