PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G21540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family EIL
Protein Properties Length: 207aa    MW: 22989.1 Da    PI: 6.6472
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G21540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3422.2e-13110174222291
                      HHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3 222 eeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkesk 291
                       ++r+l++qsk+lq+kmsakes+++++v++qee++ ++++++      + + + ++ ++++d++g ++  
  OBART02G21540.1 110 RRMRKLVWQSKRLQQKMSAKESDTWSKVIRQEEALDRRLKTSL-----HITPLDADGGEEDDSDGLEDVV 174
                      58**********************************9999987.....6678888888888888433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.103.8E-11110151IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048731.1E-6110142No hitNo description
SuperFamilySSF1167683.92E-8110144IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MASRSPTNKQ ISSEDRVRGA RGKRHHHSSD EWSMEHAEEH EHGRGGGERD DAAEPEAEQP  60
ELEQEELSDS ESVAESIEIS DLKKRMWKDQ MLLMKLEGGR PGGGGGRGRR RMRKLVWQSK  120
RLQQKMSAKE SDTWSKVIRQ EEALDRRLKT SLHITPLDAD GGEEDDSDGL EDVVRGAAAQ  180
DKRKREYTRS GSGSSSGNSG GGAGRRG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197105GGRPGGGGG
2107114GRRRMRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149581e-179AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0051161e-179AP005116.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0703B01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625091.15e-46PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A0D3F6R81e-144A0A0D3F6R8_9ORYZ; Uncharacterized protein
STRINGORGLA02G0186100.15e-47(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.11e-06EIL family protein