PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G14690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 412aa    MW: 44579.2 Da    PI: 6.6338
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G14690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32235290156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      kpr++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OBART02G14690.1 235 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.508232292IPR017930Myb domain
SuperFamilySSF466892.51E-17233293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28233293IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-27235290IPR006447Myb domain, plants
PfamPF002491.8E-6237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MEVDHADRDG ARRRCREYLL ALEEERRKIQ VFQRELPLCF DLVTQTIEGM RSQMDAAGSE  60
ETVSDQGPPP VLEEFIPLKP SLSLSSSEEE STHADAAKSG KKEEAETSER HSSPPPPPPE  120
AKKVTPDWLQ SVQLWSQEEP QQPSSPSPTP TKDLPCKPVA LNARKAGGAF QPFEKEKRAE  180
LPASSTTAAA SSTVVGDSGD KPTDDDTEKH METDKDNDKD AKDKDKEGQS QPHRKPRRCW  240
APELHRRFLQ ALQQLGGSHV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSSTGQS  300
SAAAGVPAPP APQFVVVGSI WVPPPEYAAA AAAQQHVQLA AAGNNASGSA NPVYAPVAML  360
PAGLQPHSHR KQHQQQQQGQ RHSGSEGRRS GDAGDGSSSS PAVSSSSQTT SA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-12235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-12235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-12235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-12235288154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-12235288255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0643550.0AK064355.1 Oryza sativa Japonica Group cDNA clone:002-108-B01, full insert sequence.
GenBankAK1018090.0AK101809.1 Oryza sativa Japonica Group cDNA clone:J033066M05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623779.10.0transcription factor NIGT1
SwissprotQ6Z8690.0NIGT1_ORYSJ; Transcription factor NIGT1
TrEMBLA0A0D3F4H10.0A0A0D3F4H1_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YRE50.0A0A0D9YRE5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NDZ20.0A0A0E0NDZ2_ORYRU; Uncharacterized protein
TrEMBLI1NZW80.0I1NZW8_ORYGL; Uncharacterized protein
STRINGOGLUM02G14610.10.0(Oryza glumipatula)
STRINGORUFI02G14900.10.0(Oryza rufipogon)
STRINGOS02T0325600-010.0(Oryza sativa)
STRINGORGLA02G0127400.10.0(Oryza glaberrima)
STRINGOBART02G14690.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-57G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]