PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G10190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 484aa    MW: 52403.8 Da    PI: 10.3693
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G10190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-3157110255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  OBART02G10190.1  57 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 110
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.60153113IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2953111IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1456111IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2257112IPR006447Myb domain, plants
PfamPF002498.2E-958109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MKEKEVLVEI VEDDELKRSI ESKLKGDKDS GGGRLEGING GEQRVPSVRQ YNRSKLPRLR  60
WTPDLHMAFV HAVERLGGQE RATPKLVLQM MNVRGLSIAH VKSHLQMYRS KKLDHEGRQI  120
RGAIASVFSP MDFHLMRGDR RFHDMLLQRA AALSSSRPEH GGFFSSRSGG GLPPEASRLY  180
GLLQHRQSPA MATMQTFDFK NSSFRNQEWS FSFNHQRKET MNPSSSSSTT AAIRRWPSAA  240
GAVADVAGER QRLAERFGYY TGNGGASSTS LPLITRAAMA APPPMFAAAV APPGRDHHRL  300
PFGWHAGGGG GGGGGGGGNK NRSSSDPVVI DEALDSRRLE HQQKHVEQPR TTPTTTTTPA  360
GKRPPEWSPP DLQLTLSPTT APAADGGGAK RSKTSTTTTN TTAAISGEQE AEKNMDRCKN  420
KLSISLSLSP PAAAAAAANF SSMDLSMEQQ KQKQEKTTIG SSEEEAGDLG QSTLDLTMSI  480
RALE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-1858110355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1858110355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1858110355Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1858110355Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1858110456Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0056130.0AP005613.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0082C09.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625548.10.0uncharacterized protein LOC107275964
TrEMBLA0A0D3F2Y10.0A0A0D3F2Y1_9ORYZ; Uncharacterized protein
STRINGOBART02G10190.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-35G2-like family protein