PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G05200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 201aa    MW: 22231.8 Da    PI: 7.6916
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G05200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.3e-28152455
          G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rW +eLH+rFv+av++LGG ++AtPk+i++lm+ kg++++hvkSHLQ+YR 
  OBART02G05200.1  1 MRWPEELHRRFVHAVRRLGGCHEATPKRIMQLMGAKGVSISHVKSHLQMYRN 52
                     79*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.415155IPR017930Myb domain
PfamPF002492.5E-7151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-24153IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-21152IPR006447Myb domain, plants
SuperFamilySSF466896.99E-13153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MRWPEELHRR FVHAVRRLGG CHEATPKRIM QLMGAKGVSI SHVKSHLQMY RNSNNSSNVN  60
RRHPVTPQID WTTTAQQDEQ QRRQMSSFSF LATRTVPAAG IGSHSHQRPH RRQALHAGDD  120
DGCELTLSIS GGAAEESKDG GSSITDDDDE LLIQPPAPNI INDDGSTRHG HRHPFACSTQ  180
PPPPAAINLE LTISSPCCWL T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8314000.0CT831400.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA117D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624627.11e-148transcription factor HHO5
TrEMBLA0A0D3F1721e-148A0A0D3F172_9ORYZ; Uncharacterized protein
TrEMBLI1NXM11e-147I1NXM1_ORYGL; Uncharacterized protein
STRINGORGLA02G0047700.11e-148(Oryza glaberrima)
STRINGOBART02G05200.11e-149(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1991088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-17G2-like family protein