PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G03200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 467aa    MW: 51922.9 Da    PI: 5.8101
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G03200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-33265319155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWtpeLHerFv+av++L G+ekAtPk +l+lmkv+gLt++h+kSHLQkYRl
  OBART02G03200.1 265 KPRLRWTPELHERFVDAVNKLEGPEKATPKGVLKLMKVEGLTIYHIKSHLQKYRL 319
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.818262322IPR017930Myb domain
SuperFamilySSF466891.97E-17263319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-31264320IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-25265320IPR006447Myb domain, plants
PfamPF002494.0E-9267318IPR001005SANT/Myb domain
PfamPF143796.3E-22353399IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MSTQSVIAVK QFSGPDKIAQ AYTVPQPSAH VLSNANYDYD LCGSTNSTSL SCAIQSSNIK  60
TESISSSSLP KILPFSTDSN GESSLSRMSQ AEFSDPILSS SSTFCTSLYT SSPMNSGSCR  120
KTGYLPFLPQ PPKCEQQQNS AGQSSSSLML LDADLRNSGH ADDEHTDDLK DFLNLSSDCS  180
FHGKCSAMAY NEQMEFQFLS EQLGIAISNN EESPRLDDIY DRPPQLMSLP VSSCSDQEDL  240
QDARSPAKVQ LSSSRSSSGT ASCNKPRLRW TPELHERFVD AVNKLEGPEK ATPKGVLKLM  300
KVEGLTIYHI KSHLQKYRLA KYLPETKEYK KQEEKKTKSV ANGNDHAKKK SAQMAEALRM  360
QMEVQKQLHE QLEVQRQLQL RIEEHARYLQ KILEEQQKAR ESISSMTSTT EGESPEFAPM  420
EKTEDKAETS SAPLSKCRIT DTDAECHSKV DNKKTKPQAD LEMVHDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-26265322259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0657040.0AK065704.1 Oryza sativa Japonica Group cDNA clone:J013037C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627390.10.0protein PHOSPHATE STARVATION RESPONSE 3
RefseqXP_015627391.10.0protein PHOSPHATE STARVATION RESPONSE 3
SwissprotQ6YXZ40.0PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A0D3F0H10.0A0A0D3F0H1_9ORYZ; Uncharacterized protein
TrEMBLI1NX460.0I1NX46_ORYGL; Uncharacterized protein
STRINGORGLA02G0030200.10.0(Oryza glaberrima)
STRINGOBART02G03200.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-65G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]