PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G00380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 243aa    MW: 25845 Da    PI: 4.6591
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G00380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix103.22e-3257141186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      rW+k+ev aLi++r+ +e+r+++  lk+plWeevs++m++ g++r++k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  OBART02G00380.1  57 RWPKHEVEALIRVRTGLEDRFQEPGLKGPLWEEVSARMAAAGYRRNAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 141
                      8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.95750114IPR017877Myb-like domain
PfamPF138375.7E-2456143No hitNo description
CDDcd122032.68E-3056121No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MQSGYGGVSE FQQYIMDPGA FAMSAPPQPA QAAAAAAAAA AAAAGGQELG APFSSSRWPK  60
HEVEALIRVR TGLEDRFQEP GLKGPLWEEV SARMAAAGYR RNAKRCKEKW ENINKYFRKA  120
KESGKKRPAH AKTCPYFDEL DRLYSRSGSG GGGGSSSAGG NGGEEAKGSS ELLDAVVKYP  180
DVRCAPPGFP FDGEQNEEGR TKDDGDEAHH DGDGDGDEED VGVGVGRATD DHDDQVDESH  240
DDH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622863.11e-102PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0D3EZJ11e-178A0A0D3EZJ1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA007300-PA1e-103(Oryza sativa Indica Group)
STRINGLOC_Os02g01380.11e-106(Oryza sativa Japonica Group)
STRINGORGLA02G0003500.11e-103(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63993547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.25e-40Trihelix family protein