PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G42290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 211aa    MW: 23951.8 Da    PI: 8.0286
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G42290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP107.81.6e-3383140360
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaik 60 
                      +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai 
  OBART01G42290.1  83 PKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIV 140
                      6999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.1E-2887140IPR005333Transcription factor, TCP
PROSITE profilePS5136926.3288142IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MDPKFPPPPP LNKTEPTTTT TTNQQHHHDE QQQQHRLQIQ VHPQQQEQQD GGGGGGKDQQ  60
QQQQMQVVVA AAAGERRMQG LGPKRSSNKD RHTKVDGRGR RIRMPALCAA RIFQLTRELG  120
HKSDGETVQW LLQQAEPAIV YNSRELDGLD HRCRVSALFV IAGRCVDIQV FLQLERSSFF  180
PFYESDDPLM CDKYDVRQTD PHPRAVSATQ I
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0720370.0AK072037.1 Oryza sativa Japonica Group cDNA clone:J013106J07, full insert sequence.
GenBankAP0042230.0AP004223.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1033B05.
GenBankAP0046720.0AP004672.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0592G05.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621786.16e-48transcription factor TCP20
TrEMBLA0A0D3EY161e-154A0A0D3EY16_9ORYZ; Uncharacterized protein
STRINGOBART01G42290.11e-155(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.17e-36TCP family protein