PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G39900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 458aa    MW: 49304.9 Da    PI: 8.8903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G39900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.8e-48632012128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.............kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp              +++ +ekew+f+++rd+ky++g+r+nr+t+sgy
  OBART01G39900.1  63 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPGiehlinkldggaaMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGY 155
                      79***************************.89***************557999999888764455999************************** PP

              NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      Wkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl
  OBART01G39900.1 156 WKATGADRMIRAENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 201
                      ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5262221IPR003441NAC domain
PROSITE profilePS5100553.71562222IPR003441NAC domain
PfamPF023653.1E-2464201IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MHMRRGRAAG GEGEAAAVVV MSRYDNNGHA AAAVAAAVAG GGGGGGGNKA AGEVDGHEDD  60
LVMPGFRFHP TEEELIEFYL RRKVEGKRFN VELITFLDLY RYDPWELPGI EHLINKLDGG  120
AAMAAIGEKE WFFYVPRDRK YRNGDRPNRV TASGYWKATG ADRMIRAENN RPIGLKKTLV  180
FYSGKAPKGV RSSWIMNEYR LPPADTDRYH KTEISLCRVY KRTGIDDGHG HVSTARSSAH  240
SRGGGAAPVQ DNKQGSSSTS TPTPPPTPSK LHLLSSECTS PPAIVTDHAA MAAHKAPSPR  300
HHQQQQQQLH AAKPCGGYLQ NSSMASAAGG DQQQQFQQDF AAALYQQYSK NTSGAFASTY  360
SLLNLVNAAS MGSSAAAIDE LSSLVGHGTP SYINPAAGSH NYSQFLHLPT TPSSHQPTPA  420
PLGTLPMSLA AFSDRIWDWN NPIPEAGGRD YSTSTGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-506422219165NO APICAL MERISTEM PROTEIN
1ut4_B4e-506422219165NO APICAL MERISTEM PROTEIN
1ut7_A4e-506422219165NO APICAL MERISTEM PROTEIN
1ut7_B4e-506422219165NO APICAL MERISTEM PROTEIN
4dul_A4e-506422219165NAC domain-containing protein 19
4dul_B4e-506422219165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1029020.0AK102902.1 Oryza sativa Japonica Group cDNA clone:J033113D13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631974.10.0NAC domain-containing protein 35
TrEMBLA0A0D3EX700.0A0A0D3EX70_9ORYZ; Uncharacterized protein
STRINGOBART01G39900.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.29e-98NAC domain containing protein 35