PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G21400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 144aa    MW: 15572 Da    PI: 10.2472
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G21400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP67.93.4e-211462469
              TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssss 69
                     ++ +caar+F+L++eLG+++d++t++WLlqqa+ ai  +tgt+  +
  OBART01G21400.1  1 MPTLCAARIFQLTRELGHKSDGETVQWLLQQAELAIVTATGTGVGA 46
                     899***************************************4433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.6E-16142IPR005333Transcription factor, TCP
PROSITE profilePS5136918.91139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MPTLCAARIF QLTRELGHKS DGETVQWLLQ QAELAIVTAT GTGVGADIRR TLPLFPKLRP  60
LQVAPPPPPH VGCRRGVRRC HIGFATMFAA HAAAAMPGLE LGLSQDGHIG MLFARSLSQF  120
YHQVGGASAA GQLPHPHHHH QHHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032530.0AP003253.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0451D05.
GenBankAP0033330.0AP003333.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1103C09.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638501.29e-49LOW QUALITY PROTEIN: transcription factor TCP20
TrEMBLA0A0D3EQS66e-99A0A0D3EQS6_9ORYZ; Uncharacterized protein
STRINGOBART01G21400.11e-99(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.15e-21TCP family protein