PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630947.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 999aa    MW: 111660 Da    PI: 7.1129
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630947.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix28.34.6e-092272872182
        trihelix  21 lrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82 
                      +rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++ + e+  + +yf
  XP_009630947.1 227 QGRGKTRADKDREVADFLNRHGVSRDAKTAGTKWDNMLGEFRKVYEWERGAEREQ-GSKSYF 287
                     45788999999**************************************974444.355666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.510.102.2E-6813946No hitNo description
CDDcd001809.61E-16831984No hitNo description
SuperFamilySSF561121.35E-16841983IPR011009Protein kinase-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MDENKGETTK KQPPPPQQQH LSNSPNDSNQ DSPDNTIPQQ QQQQPPQTVI SGASYISSSL  60
YNIPGGAATT SVSFEQQQQQ LQFEVVNPKR PRYTASQWKF IPSSSSQQQQ QNPSQVNILS  120
TESSPISPSP QAAAATNPQT QAASSSDTAS SPSHSPRPSA SGQETSKGEG GEQVHQQFRK  180
GKYVSPVWKP NEMLWLARAW KIQYQGGSSE LHLEGSQEMS TGAGVQQGRG KTRADKDREV  240
ADFLNRHGVS RDAKTAGTKW DNMLGEFRKV YEWERGAERE QGSKSYFRLS PYERKMNRLP  300
ASFDEEVFEE LSQFMGSRMR SPQTRGVGAG FGSQANIVVS LSDTVTKSLP PPPPFREDDL  360
PLSARAKQLA IPISGTEALL HGTRSGFLGY DTTTTSSLDI GGPSSSASSK ELRRIGKIRM  420
IWEESVSLWA EEGEHHRGRV KLQGTSFLNA DEIAFLDDST VACTMEAFED GPMKGFSVDR  480
FLSGVQLKVF GRRKSSSAPA LSGPNERLQL PSSEFPIKST TPWEFQDPTE YYVGCLRSPP  540
PTLPSLFELS WHLQQPPPEE LRFPLRRDVF KDLPQGKELF FTISTELLDC RGITYEVLSS  600
IMRPNPSLST ATDRDSYIGL WDDCINRIIS KFCSIEMVFV RKSNSSFSLA ETVQDQWPNV  660
TAFLRNFCLW RGEETGQLSE GQLDPSSSIV EKLLWTYMDL PYVLGYYAVG FIVTFCALSR  720
SQDRIIRTDL YTVDLSTPVE RLKALVPCWR IAGLLPLLAD RCFHYMSSNG SNLKHLPYTD  780
FERIDLGNGN IVEMTPNTVV RYFSSKRKWV AVKEIYDFLD HRIPHAEFVV RASEKDLALV  840
FKPRGCKFKP ANCDQLIEAL KQITKALVAL HDLSFMHRDL GWDKVMRRSD RENEWFITGF  900
DEAVSSPQLY PYGGAAAATA ASGRHPPEMV RNYHNVKVDV WGIGQLVKSC GLVGVPKLLR  960
ELQNRCLDQN PEQRPTAADC YRHLLQLQSS MSAAAAGGY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630947.10.0PREDICTED: uncharacterized protein LOC104120810
TrEMBLA0A1S3Z1J30.0A0A1S3Z1J3_TOBAC; uncharacterized protein LOC107781956
STRINGXP_009630947.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129361416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.11e-07Trihelix family protein