PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629634.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 521aa    MW: 57872.1 Da    PI: 5.2355
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629634.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.43.1e-1281525212374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +elLl+cAeavs+  + +a+ l++ l++ +s +g+pmqRl ay++e+++arl++s+s +yk+l+++e +    se l++++++++++P++kf++ 
  XP_009629634.1 152 KELLLACAEAVSDAYFPAAEVLMNVLEHKVSVSGEPMQRLSAYMLEGIRARLFSSGSIIYKKLKCKEPT---NSELLSYMQVLYHICPYYKFAYT 243
                     689*****************************************************************9...89********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN  I ea+++e+r+HiiDf+i qG QW+ L+q+La Rp+gpps+RiTgv++++s   +   l+ +gerLak+Ae+++vpfef++ +a +  ++
  XP_009629634.1 244 SANVVIDEAMANENRLHIIDFQIAQGSQWMFLIQSLARRPGGPPSVRITGVDDSQSAhaRGGGLQLVGERLAKVAESCRVPFEFHA-AAISGYEV 337
                     *****************************************************9988889999***********************.888999** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ele+L +++gEalaVn+ + lh+++desvs++++rd++L+lvkslsPk+v++veqe+++n++ F+ rf e+l+yy+a+f+s++a+ pr++++ri+
  XP_009629634.1 338 ELENLYIRNGEALAVNFPYILHHMPDESVSTANHRDRLLRLVKSLSPKIVTLVEQESNTNTAAFVPRFRETLDYYTAMFESIDAGRPRDDKQRIS 432
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      E+++++r++vn++acega+r+erhe ++kW++rl++aGF+p pls ++ + ++ +l+ ++s+ yr+ e++g+l+lgWk+r+L + SaWr
  XP_009629634.1 433 AEEHCVARDVVNIIACEGADRVERHELFGKWSMRLKMAGFTPCPLSPSVGEAINDMLKDYSSN-YRIAESKGALYLGWKNRALATSSAWR 521
                     *************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.756125502IPR005202Transcription factor GRAS
PfamPF035141.1E-125152521IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MQASQRPMEK VEQYYYVFNN NSNDTSSSGT QFSCQSQNEQ FFTLDSLPAA GYVIYDSPPA  60
VSVSSNWSPF SPQYSQSTIS DQHHSSDNTY GSPLSGCSGV DGVLSEMANK LLGPESDIDD  120
SSCCSFNDVV SEPSSPTKWN RVLEIASSLD VKELLLACAE AVSDAYFPAA EVLMNVLEHK  180
VSVSGEPMQR LSAYMLEGIR ARLFSSGSII YKKLKCKEPT NSELLSYMQV LYHICPYYKF  240
AYTSANVVID EAMANENRLH IIDFQIAQGS QWMFLIQSLA RRPGGPPSVR ITGVDDSQSA  300
HARGGGLQLV GERLAKVAES CRVPFEFHAA AISGYEVELE NLYIRNGEAL AVNFPYILHH  360
MPDESVSTAN HRDRLLRLVK SLSPKIVTLV EQESNTNTAA FVPRFRETLD YYTAMFESID  420
AGRPRDDKQR ISAEEHCVAR DVVNIIACEG ADRVERHELF GKWSMRLKMA GFTPCPLSPS  480
VGEAINDMLK DYSSNYRIAE SKGALYLGWK NRALATSSAW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-551555218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629634.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016490832.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLM1AFN30.0M1AFN3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000217480.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13