PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 624aa    MW: 68913.7 Da    PI: 6.2356
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.11.1e-842646234374
            GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     + +++ e + +g++++aq +Larl+++ sp g+p++R a+yf+eAL+   +   + ++ ++pp+  ++ + + ++ a+k+fse+sP+++f ++t 
  XP_009628961.1 264 QFFQASELLLAGQFSNAQMILARLNQQLSPIGKPFKRSAFYFKEALQLPFLL--PCTSTSFPPRIPTPFDCVLKMDAYKAFSEISPLIQFMNFTS 356
                     67888999999************************************99998..7777889****9999************************** PP

            GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle..dlel 191
                     Nq Ilea+  ++++HiiDfdi+ G+QW +++q+L s ++++ sl+iT+++sp+++++ e+  ++e L+ fA+ +g++fe +v+  ++++  +  l
  XP_009628961.1 357 NQPILEALGDAKQIHIIDFDIGCGAQWSSFMQELRSSNRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDpkTYPL 451
                     **********************************************************************************9777654115678 PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     ++Lr ++ Ea+a+n+ +   +      +     +++L+++k+lsPkvvv  e+ +++++ ++ +++l+al+yy  l+ s++a    + e  +k+E
  XP_009628961.1 452 SSLRSSECEAIAINFPIWSISSC--LFA----FPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLLHALQYYEILLASIDAA-NLTPEIGKKIE 539
                     999************99555444..344....456*********************************************555.34778999*** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r ll+++i+n+v  + ++      ++  Wr+ + +aGF+p+++s+ a+ qa+++++++++ g++ve+++ slvl+Wk+++L+s+ aWr
  XP_009628961.1 540 RSLLQPSIENMVLGRLRS----PDRMPPWRNLFASAGFSPIEFSNMAEIQAECVVKRTQVGGFHVEKRQTSLVLCWKQQELLSILAWR 623
                     *************99988....9999*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.732235603IPR005202Transcription factor GRAS
PfamPF035143.6E-82264623IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MLVTTSHSPS ASASSCSYGG NMAEKSDLGF GDLDNLLPEL AGSDQTLFRC ISGDMEDPSV  60
SLKQLLQGGN ANADLGCGVS VQSSGFEVSA AGSLAHTDNV SFSNSNLLLN ANIEKIGSVI  120
NSDNKQNVNF EHLNVNLLAR NLPPALSFQE QPSEQNSAYV NMLGSLSYDI SQEQPPPKRH  180
NSGTLGSSLS ALLPEVPFFD SSGDLLLRKQ PLGQMRQQVN FLPFHQFQQK PLIVPKLEAA  240
GGGGNGNLIV PRHQQQEQQF IYDQFFQASE LLLAGQFSNA QMILARLNQQ LSPIGKPFKR  300
SAFYFKEALQ LPFLLPCTST SFPPRIPTPF DCVLKMDAYK AFSEISPLIQ FMNFTSNQPI  360
LEALGDAKQI HIIDFDIGCG AQWSSFMQEL RSSNRKATSL KITAFVSPST HHSVEIGIMH  420
ESLTLFANDV GIRFELEVIN LDSFDPKTYP LSSLRSSECE AIAINFPIWS ISSCLFAFPS  480
LLHCMKQLSP KVVVSLERGC ERTELPLKHH LLHALQYYEI LLASIDAANL TPEIGKKIER  540
SLLQPSIENM VLGRLRSPDR MPPWRNLFAS AGFSPIEFSN MAEIQAECVV KRTQVGGFHV  600
EKRQTSLVLC WKQQELLSIL AWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2628462326375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628961.10.0PREDICTED: scarecrow-like protein 6
RefseqXP_016487314.10.0PREDICTED: scarecrow-like protein 6
TrEMBLQ8LL100.0Q8LL10_PETHY; Hairy meristem
STRINGPGSC0003DMT4000121040.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.14e-99GRAS family protein