PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 714aa    MW: 78067 Da    PI: 6.5069
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628960.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.72.1e-863537133374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     ++++++ e + +g++++aq +Larl+++ sp g+p++R+a+yf+eAL+   +   + ++ ++pp+  ++ + + ++ a+k+fse+sP+++f ++t
  XP_009628960.1 353 DQIFQASELLLAGHFSNAQMILARLNQQLSPIGKPFKRAAFYFKEALQLPFLL--PCTSTSFPPRIPTPFDCVLKMDAYKAFSEISPLIQFMNFT 445
                     57899999999*************************************99998..7777889****9999************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle..dle 190
                      NqaIlea+  ++++HiiDfdi+ G+QW +L+q+L s ++++ sl+iT+++sp+++++ e+  ++e L+ fA+ +g++fe +v+  ++++  +  
  XP_009628960.1 446 SNQAILEALGAAKQIHIIDFDIGCGAQWSSLMQELPSSNRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDpkTYP 540
                     ***********************************************************************************977765411567 PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerik 284
                     l++Lr ++ Ea+a+n+ +   +      +     +++L+++k+lsPkvvv  e+ +++++ ++ +++l+al+yy  l+ s+ +a+   + +  +k
  XP_009628960.1 541 LSSLRSSECEAIAINFPIWSISSC--LFA----FPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLLHALQYYEILLASIdAAN--LTPDVGKK 627
                     8999************99555444..344....456*********************************************5555..4778999* PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +Er l++ +i+n+v  + ++      +   Wr+ + +aGF+pv++s+ ++ qa++l++++++ g++ve+++ slvl+Wk+r+L+s+ +Wr
  XP_009628960.1 628 IERSLFQSSIENMVLGRLRS----PDRIPPWRNLFASAGFSPVAFSNLTEIQAECLVKRTQVGGFHVEKRQSSLVLCWKQRELLSALSWR 713
                     ***************99988....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542325693IPR005202Transcription factor GRAS
PfamPF035147.3E-84353713IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MIVIPQSNNL AVAKGVLGVS SYVPSISSST EAPICNKGLT FTRNESVSVL DTRSPSPSAS  60
SSSCSYGGQH AGNNGVPGAG AGKIDGRKEE LVTELQPFSF GLEPEKFNLG FGDLDNLLPE  120
LAGSDQTIFR WISGDMEDPS VSLKQLLQGG NANADLGGGV SVAGSFACTD NISFSSSDIS  180
LDANIEKIGY AVIDSNNRPN NNFENLNANL LAKSLPPALS FQEQQSEEKP QISCPQIVAN  240
QTQFQNSAYV NLFGSSSYNM NQEQPPPKRH NSGILGSSLG FLLPKVPFFS PSGDLLLRKQ  300
PLGQMQQQVN LLPPHQFQPT PLFVPKLEAA GGGGNGNLVV PRHQQQEQQF IYDQIFQASE  360
LLLAGHFSNA QMILARLNQQ LSPIGKPFKR AAFYFKEALQ LPFLLPCTST SFPPRIPTPF  420
DCVLKMDAYK AFSEISPLIQ FMNFTSNQAI LEALGAAKQI HIIDFDIGCG AQWSSLMQEL  480
PSSNRKATSL KITAFVSPST HHSVEIGIMH ESLTLFANDV GIRFELEVIN LDSFDPKTYP  540
LSSLRSSECE AIAINFPIWS ISSCLFAFPS LLHCMKQLSP KVVVSLERGC ERTELPLKHH  600
LLHALQYYEI LLASIDAANL TPDVGKKIER SLFQSSIENM VLGRLRSPDR IPPWRNLFAS  660
AGFSPVAFSN LTEIQAECLV KRTQVGGFHV EKRQSSLVLC WKQRELLSAL SWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-2937471326375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628960.10.0PREDICTED: scarecrow-like protein 22
TrEMBLQ8LL100.0Q8LL10_PETHY; Hairy meristem
STRINGPGSC0003DMT4000121040.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.12e-99GRAS family protein