PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 513aa    MW: 58585.5 Da    PI: 5.8389
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628661.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.39.8e-921425112374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl.fsevsPilkfs 94 
                      + Ll++Ae vs+++  +a+++L + + l+s++g+p qR+++yf++AL++r+ r++ +l  ++++ et+ +   ++++ a +l f++  P+ ++ 
  XP_009628661.1 142 AQILLAAAEKVSDQQYDRARKMLMQCQLLSSNTGNPAQRAVFYFAQALEERIDRETGRLIPKIHSVETDGSIcIASRFDASHLaFHQEVPFTQVV 236
                     689***************************************************999998888888887655766666666667*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                     h+t  qaIle+v+++++vH iDf i  G+QW++L+qa a+R+ ++  +++iT+v+s   ++ke++eetg+ L++fA++l+ pf+f+++   + ++
  XP_009628661.1 237 HFTGIQAILESVATKSKVHLIDFLIRTGVQWASLIQAAAERKdNPIEHMKITVVES---VNKERVEETGKSLESFAKSLNFPFSFKIVFLPDRNQ 328
                     *****************************************955566*********...78**************************9999**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ ++++vkp+E +++  ++ l  +  e+ +le      ++++++l+P+++vv+e ea++ns+ F++rf+++l yysa+fd+le  + r++++r+
  XP_009628661.1 329 LTEDHFDVKPDEGVVIYAAFFLRAMICEPNCLET----AMRVIRRLQPELMVVSEVEANLNSPMFVNRFIDSLFYYSAFFDCLEDVMKRDDQHRM 419
                     **************************88888888....********************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++E +  g  i+n+v  eg+er+ +  +l  Wr+ ++++G+++v+lse+   qa+l++++++  +  + + +  sl+  Wk+ p++++SaW+
  XP_009628661.1 420 TLESVTYGGGIRNIVGSEGKERVCKSVNLDVWRSFFKRFGMEEVKLSETCLYQANLIIEQFAcRNSCSADVNGRSLTVSWKGTPIYFTSAWK 511
                     **************************************************************888899999999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.426115490IPR005202Transcription factor GRAS
PfamPF035143.4E-89142511IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MEDSTDIQNF CTNYGFYQEY AANPQVQETN KQQEEMNVYA VTPQVQTGSH VDKTPFLSLA  60
PFELLRNNPS RWKNTEGDKV RNLNEGTNAY QKLSAMQIMR LAGERFIQFS SNKFININNL  120
LHLYGSALSN LSPEDNQDVE LAQILLAAAE KVSDQQYDRA RKMLMQCQLL SSNTGNPAQR  180
AVFYFAQALE ERIDRETGRL IPKIHSVETD GSICIASRFD ASHLAFHQEV PFTQVVHFTG  240
IQAILESVAT KSKVHLIDFL IRTGVQWASL IQAAAERKDN PIEHMKITVV ESVNKERVEE  300
TGKSLESFAK SLNFPFSFKI VFLPDRNQLT EDHFDVKPDE GVVIYAAFFL RAMICEPNCL  360
ETAMRVIRRL QPELMVVSEV EANLNSPMFV NRFIDSLFYY SAFFDCLEDV MKRDDQHRMT  420
LESVTYGGGI RNIVGSEGKE RVCKSVNLDV WRSFFKRFGM EEVKLSETCL YQANLIIEQF  480
ACRNSCSADV NGRSLTVSWK GTPIYFTSAW KFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-4516451126375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628661.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1DFW30.0M1DFW3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000884000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139101114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-55RGA-like 1