PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 565aa    MW: 63319.4 Da    PI: 4.8819
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628414.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS446.32.1e-1361975653374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + L++cA a+++g+ e+a++++++l++++s +g+p++R aay++eALaar+a s+++lykal+++e+     se+l+a+++++ev+P+++f++++
  XP_009628414.1 197 QMLFSCAAAIQDGNIEQASSMINELRQMVSIQGEPLERTAAYMVEALAARMATSGKGLYKALKCKEAL---FSERLSAMQVLFEVCPYFRFGFMA 288
                     79*****************************************************************8...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aIlea++ e+rvHiiDfdi+qG Q+ +Llq+Las p++pp+lR+Tgv++pes       l+ +g rL+++A+ l++pfef++ va++++ ++
  XP_009628414.1 289 ANGAILEAFKDEKRVHIIDFDINQGSQYYTLLQTLASMPGKPPHLRLTGVDDPESIqrAIGGLNVIGLRLEELAKDLKIPFEFQA-VASNTALVT 382
                     ******************************************************99777789***********************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     + +L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+r++e  +yysa+f+sl+a+l+r+s+er++v
  XP_009628414.1 383 PAMLNCHPGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTTPFLQRVAEVHNYYSAVFESLDATLSRDSQERVNV 477
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     Er++l+r+i n+vaceg+er+er e ++kWr+r+++aGF+p p+s +++++++ l+++++++ y+ +ee g+l +gW+d++L+++SaW+
  XP_009628414.1 478 ERQCLARDIINIVACEGEERIERYEVAGKWRARMMMAGFTPSPISRNVYDSIQNLIKQYSER-YKAKEEAGALHFGWEDKSLIVASAWK 565
                     ************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.19169546IPR005202Transcription factor GRAS
PfamPF035147.4E-134197565IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MSLVRSVRTI GNGKLYFPND HNDNSGLSTS MFTKNARGIM YATESSSTDS YDPKYLLDSP  60
SPSEELLNIS PSEVSGNPFH PRHSSSFQPS RDYDACQVRY DCEDIVSQRP DSLQYNDGRV  120
TLKLQELERV LFDDNEVDGD DVFARGQCMD IDDEWFSKIG TVLLHDSPKE STSADSNISS  180
SSSYKEISVT APQTPKQMLF SCAAAIQDGN IEQASSMINE LRQMVSIQGE PLERTAAYMV  240
EALAARMATS GKGLYKALKC KEALFSERLS AMQVLFEVCP YFRFGFMAAN GAILEAFKDE  300
KRVHIIDFDI NQGSQYYTLL QTLASMPGKP PHLRLTGVDD PESIQRAIGG LNVIGLRLEE  360
LAKDLKIPFE FQAVASNTAL VTPAMLNCHP GEALIVNFAF QLHHMPDESV STVNQRDQLL  420
RMVKSLNPKL VTVVEQDMNT NTTPFLQRVA EVHNYYSAVF ESLDATLSRD SQERVNVERQ  480
CLARDIINIV ACEGEERIER YEVAGKWRAR MMMAGFTPSP ISRNVYDSIQ NLIKQYSERY  540
KAKEEAGALH FGWEDKSLIV ASAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-591975656375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankDQ3998280.0DQ399828.1 Lycopersicon esculentum GRAS6 (GRAS6) mRNA, complete cds.
GenBankBT0135910.0BT013591.1 Lycopersicon esculentum clone 132354R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628414.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628413.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628412.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628411.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_009628410.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501232.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501231.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501230.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501228.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501227.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016501226.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1