PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 470aa    MW: 53273.1 Da    PI: 6.5672
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627602.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS463.41.3e-141474671374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++v++g+le+a+ +L ++s+lasp+gd+mqR+a+yf+eALa r++rs++++ykal++++ s   +se + + k+f+e +P+lk++ 
  XP_009627602.1  47 LIHLLLTCANHVAAGNLENANIALDQISQLASPKGDTMQRIASYFAEALADRILRSWPGIYKALHSTKLS--IVSEDILVKKMFFEYFPFLKVAS 139
                     689*************************************************************999998..69********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     l++NqaI ea+ege++vHi+D+++s++lQW aLlq L +Rpegpp+lRiTgv++    +ke le++++ L++ Ae+l++pf+f+  v+++le+l+
  XP_009627602.1 140 LITNQAIIEAMEGEKMVHIVDLNASEPLQWRALLQDLRARPEGPPHLRITGVHQ----QKEVLEQIAHVLTEEAEKLDIPFQFHQ-VVSKLENLD 229
                     ******************************************************....9**************************.799****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll......................................................desvsleserdevLklv 231
                     +e+Lrvk+gEala+++v+qlh+ll                                                        s + + ++d +L ++
  XP_009627602.1 230 VEKLRVKTGEALAISSVMQLHTLLahddepqkksplgfkhlnglhlqrallnqntlgdllekettnvfspgnesasssPLSPTAPAKIDGFLYAL 324
                     ***********************************************************************9998765223333337899***** PP

            GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                     ++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s er kvE++l+g+ei+n+vaceg er+erhe+l kW +r++ a F++
  XP_009627602.1 325 WGLSPKVMVVTEQDSNHNGTTLMERLSESLYFYAALFDCLEFTLQRTSLERLKVEKMLFGEEIKNIVACEGVERKERHEKLDKWFQRFDGASFRN 419
                     *********************************************************************************************** PP

            GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vpls++a+ qa++ll+ ++ +gy+++ee+g++v++W+dr L+svSaWr
  XP_009627602.1 420 VPLSYYAMLQARRLLQSYSCEGYKIKEENGCVVICWQDRVLFSVSAWR 467
                     ***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.8621447IPR005202Transcription factor GRAS
PfamPF035144.6E-13947467IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLQNFP MTSLSPSLNS PYHWLKELKS EERGLYLIHL LLTCANHVAA  60
GNLENANIAL DQISQLASPK GDTMQRIASY FAEALADRIL RSWPGIYKAL HSTKLSIVSE  120
DILVKKMFFE YFPFLKVASL ITNQAIIEAM EGEKMVHIVD LNASEPLQWR ALLQDLRARP  180
EGPPHLRITG VHQQKEVLEQ IAHVLTEEAE KLDIPFQFHQ VVSKLENLDV EKLRVKTGEA  240
LAISSVMQLH TLLAHDDEPQ KKSPLGFKHL NGLHLQRALL NQNTLGDLLE KETTNVFSPG  300
NESASSSPLS PTAPAKIDGF LYALWGLSPK VMVVTEQDSN HNGTTLMERL SESLYFYAAL  360
FDCLEFTLQR TSLERLKVEK MLFGEEIKNI VACEGVERKE RHEKLDKWFQ RFDGASFRNV  420
PLSYYAMLQA RRLLQSYSCE GYKIKEENGC VVICWQDRVL FSVSAWRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-21474674375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627602.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_016500456.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM1C2Q40.0M1C2Q4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000584770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3