PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625296.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 542aa    MW: 60461.4 Da    PI: 6.0879
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625296.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.52.4e-1271725421374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+elL++cAeavs+ d + a+ l++ l++ +s +g+pm+Rl ay++e+L+arl++s+s +yk+l+++e +   sse l+++++  +++P++kf++
  XP_009625296.1 172 LKELLVACAEAVSDADISTAEILMNILEQKVSVSGEPMERLSAYVLEGLRARLLSSGSIIYKKLKCKEPT---SSELLSYMQVICNMCPYYKFAY 263
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN  I ea+++e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp + iTgv++++s   +   l+ +gerLa +A+++gvpfef+  +a +  +
  XP_009625296.1 264 MSANVVIREAMANENRIHIIDFQIAQGSQWMFLLHYLARRPGGPPFVCITGVDDSQSAhaRGGGLQLVGERLAAVAKSCGVPFEFHG-AALSGCE 357
                     ******************************************************9988889999***********************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+Lrv++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++Fl rf e+l+yy+a+f+s++a  pr++++ri
  XP_009625296.1 358 VQLENLRVRHGEALAVNFPFMLHHMPDESVSTINHRDRLLRLVKSLSPKIVTLVEQESNTNTAPFLPRFRETLDYYTAMFESIDAARPRDDKQRI 452
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r++vn++acega+r+erhe l+kWr rl++aGF+p pls ++ ++++ +l++++ + yr  e++g+l+lgWk+r+L + SaWr
  XP_009625296.1 453 SAEEHCVARDVVNIIACEGADRVERHELLGKWRLRLMMAGFTPCPLSPSVGETINDMLKEYSPN-YRFAESEGALYLGWKNRALATSSAWR 542
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.989146523IPR005202Transcription factor GRAS
PfamPF035148.4E-125172542IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQTSQRPQMS GGVHGLYNQP MQQVEQYYAP YHFKNNNCNN TSSVTQFAFQ TQNEHFFTLD  60
SLPATDYVVY DSPPALSVSS NRSPFSPQCS QSYMSDLHHS SDNNTCGSPF SGCSGVDDGD  120
LKHVLRELEN KLLGPESDTD DSCSCSFNDV VSKPSSLTRW NRVLDIAPSL NLKELLVACA  180
EAVSDADIST AEILMNILEQ KVSVSGEPME RLSAYVLEGL RARLLSSGSI IYKKLKCKEP  240
TSSELLSYMQ VICNMCPYYK FAYMSANVVI REAMANENRI HIIDFQIAQG SQWMFLLHYL  300
ARRPGGPPFV CITGVDDSQS AHARGGGLQL VGERLAAVAK SCGVPFEFHG AALSGCEVQL  360
ENLRVRHGEA LAVNFPFMLH HMPDESVSTI NHRDRLLRLV KSLSPKIVTL VEQESNTNTA  420
PFLPRFRETL DYYTAMFESI DAARPRDDKQ RISAEEHCVA RDVVNIIACE GADRVERHEL  480
LGKWRLRLMM AGFTPCPLSP SVGETINDML KEYSPNYRFA ESEGALYLGW KNRALATSSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-561725425375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625296.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLK4D6550.0K4D655_SOLLC; Uncharacterized protein
STRINGSolyc11g012510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13