PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 767aa    MW: 87164 Da    PI: 5.968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS378.21e-1153947651374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+av+++d + a++lL++++ ++sp gd +qRla++f+ +++arla+++s++ykal  ++ts    ++ l+a++l+   sP+ k+s 
  XP_009622917.1 394 LRTLLINCAQAVAADDCRSATELLKQIRLHSSPFGDGNQRLAHCFADGMEARLAGTGSQIYKALVNKKTS---AADFLKAYHLYLASSPFRKLSD 485
                     6789************************************************************999999...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++ N++I+  + ++ rvH+iDf+i +G+QWp+L+q +a+R++gpp+lRiTg++ p++g   +e++eetg+rLa++A++++vpfe+++ +ak++e+
  XP_009622917.1 486 FASNKTIMTKAGNAARVHVIDFGILYGFQWPTLIQRIAAREGGPPKLRITGIEFPQPGfrPAERIEETGRRLADYAQTFNVPFEYHA-IAKKWET 579
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L+++++E l+Vn+ ++ ++l+de+v ++s r+ vL+l+++++P+++++   +  ++++ F++rf e l ++salfd+lea++pres er+
  XP_009622917.1 580 IRLEDLKLEKDEFLVVNCLYRFKNLPDETVLTDSSRTLVLDLIRKINPDIFIHGIVNGAYSAPFFVTRFREVLFHFSALFDMLEANVPRESPERM 674
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +Ere++gre+ nv+aceg er+er et+++W+ r  +a F ++p++ ++++ a   +   + + + ++e++++l+lgWk+r+++++S+W+
  XP_009622917.1 675 LIEREIFGREALNVIACEGWERVERPETYKQWQVRNLRARFMQIPFEREVMNRATEKVTSSYHKDFVLDENNKWLLLGWKGRTIYALSCWK 765
                     ***********************************************************999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.668368745IPR005202Transcription factor GRAS
PfamPF035143.6E-113394765IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MDPRFNNFPT SMNGFSLENQ SVHISSNRWK NNEPRFEAIY QDQKLVNGPR FENNFVPKNI  60
GGIQSVSNDP LPTSNIALTS DIGAEDEYNE DFDFSDTVLS YINQMLMEED VEDKTHMLQE  120
SLEFQAKEKS FYEALSKEYP PSPQQNLSIT YQNGEIPNEY CSGSLYNFTS NSNDSSDYLT  180
DPTVINISND LKSSYVQGLS VCNGTYSSIS SSSSINNIVD GFLDSPVSPL HNPDIYNDSY  240
PIWNFRKGVE EANKFLPTNI KLLDNVDING LLPLEKRGES GCVAARVEKR DEGEVSPTEP  300
RGRKNPHRDD KDLLEEERSS KQAAVYTEST VRSEEFDIVL LHSLGNGKEA LEAYRESLKN  360
ARTKNTVQNG QSKGYNGGKG RGKKHSGKKE VVDLRTLLIN CAQAVAADDC RSATELLKQI  420
RLHSSPFGDG NQRLAHCFAD GMEARLAGTG SQIYKALVNK KTSAADFLKA YHLYLASSPF  480
RKLSDFASNK TIMTKAGNAA RVHVIDFGIL YGFQWPTLIQ RIAAREGGPP KLRITGIEFP  540
QPGFRPAERI EETGRRLADY AQTFNVPFEY HAIAKKWETI RLEDLKLEKD EFLVVNCLYR  600
FKNLPDETVL TDSSRTLVLD LIRKINPDIF IHGIVNGAYS APFFVTRFRE VLFHFSALFD  660
MLEANVPRES PERMLIEREI FGREALNVIA CEGWERVERP ETYKQWQVRN LRARFMQIPF  720
EREVMNRATE KVTSSYHKDF VLDENNKWLL LGWKGRTIYA LSCWKPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-453987658375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622916.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_009622917.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK4D4840.0K4D484_SOLLC; Uncharacterized protein
STRINGSolyc10g086530.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein