PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620744.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 539aa    MW: 60869.8 Da    PI: 4.9659
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620744.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.15.3e-1021575321374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalklfsevsPilkf 93 
                     lv+lLl+cAeav  +d++l ++lL+++   ++p gd++qR+  +f+ +L++rl+   + ++  ++l   + +  + +e+  a++ +++++P++ f
  XP_009620744.1 157 LVHLLLACAEAVGCRDTRLSDSLLTQIWPAVTPFGDSLQRVSYCFALGLQSRLTLlqHRNNAGATLIQDQLAALSRVEKREAYHWLNQITPYMAF 251
                     68**************************************************998323334444444555555558899999************* PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egpp.slRiTgvgspesgskeelee.tgerLakfAe..elgvpfefnvlva 183
                     ++++aN aI +a +g+e++HiiD+++   +QW +L+++L+++p ++pp  +RiTg+ + +++   ele  +++ + ++A+  + ++++ef+v+ +
  XP_009620744.1 252 GFMAANDAICKASSGKECLHIIDLGMLRIFQWQSLIRTLTAQPdSPPPrLVRITGILEDTHD-FMELELgLKSLMDEVAAtsSGNIRLEFQVIKE 345
                     *******************************************55555689*******6655.4444431555566666511569*******844 PP

            GRAS 184 k.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + + ++ e+L+v++gEal+Vn+v+qlh+ ++es  + +   ++L+++k+l P +v+vveq+a+hn++ Fl rfle+l+yysa+fdslea+lpr
  XP_009620744.1 346 PvSASLFTREKLDVREGEALIVNSVMQLHKYVKESRGSLK---TILQAIKKLGPALVIVVEQDANHNGPFFLGRFLESLHYYSAVFDSLEASLPR 437
                     4588999*************************88777666...9*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                     +s +rik+E+   ++ei+n+va eg++r+erhe++ +Wr++l++aGF+ v l+   ++q++++l+ ++sdgy++ +e+g+l+lgWk+rp++++Sa
  XP_009620744.1 438 DSTTRIKIEKCHYAEEIRNIVAYEGSNRIERHERADQWRRQLGRAGFQVVGLK--CMSQVRMMLSVYGSDGYTLASEKGCLLLGWKGRPIMFASA 530
                     **************************************************995..89************************************** PP

            GRAS 373 Wr 374
                     W+
  XP_009620744.1 531 WE 532
                     *5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.14131514IPR005202Transcription factor GRAS
PfamPF035141.8E-99157532IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MHEMNSDWVL SFQSHNQDFA IRQFCAAARM IDQEQQQQHS QNSIGELYTY TSTPDHSASS  60
QEEQEFVDSF FNIDSYDKDP LDQQVNLDVE EFGDFTSMIL NEYSYKNLSV LTDEEPRYTV  120
LEACSSSDDL IGAEKPFDAE TISHDHVEAE VNQGLQLVHL LLACAEAVGC RDTRLSDSLL  180
TQIWPAVTPF GDSLQRVSYC FALGLQSRLT LLQHRNNAGA TLIQDQLAAL SRVEKREAYH  240
WLNQITPYMA FGFMAANDAI CKASSGKECL HIIDLGMLRI FQWQSLIRTL TAQPDSPPPR  300
LVRITGILED THDFMELELG LKSLMDEVAA TSSGNIRLEF QVIKEPVSAS LFTREKLDVR  360
EGEALIVNSV MQLHKYVKES RGSLKTILQA IKKLGPALVI VVEQDANHNG PFFLGRFLES  420
LHYYSAVFDS LEASLPRDST TRIKIEKCHY AEEIRNIVAY EGSNRIERHE RADQWRRQLG  480
RAGFQVVGLK CMSQVRMMLS VYGSDGYTLA SEKGCLLLGW KGRPIMFASA WEVHNVASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-411575314374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620744.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016508607.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLW9QHI80.0W9QHI8_9R
STRINGPOPTR_0005s09790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA140671113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-73RGA-like 1