PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620664.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 465aa    MW: 53124.7 Da    PI: 6.6488
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620664.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.11.8e-90854611373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ Ll  A+av++++   a + L++l +++s  gd++qR+aayf+ +L arl+   s  y+ +   +t+    +ee+ a++ f++vsP+++f+h
  XP_009620664.1  85 LIHSLLISATAVDENSIDSAVENLQELYQNVSLLGDSVQRVAAYFADGLIARLLTRNSPFYDMIIKLPTQ----EEEFLAFTEFYKVSPFYQFAH 175
                     57999999***********************************************9*****998777775....68889999************* PP

            GRAS  96 ltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlv 182
                     +t NqaIlea+e+e       +H+iDf is+G+QWp+L+q+L++ +  ++  sl+iTg g+      +el+et+ rL +fA+ + +++fef+ + 
  XP_009620664.1 176 FTSNQAILEAFEKEentnnGFLHVIDFAISYGFQWPSLIQSLSENAttSNRISLKITGYGK----TIDELRETETRLVSFAKGFrNLSFEFQGI- 265
                     *************976666678*********************988656677*********....99***************9758*******8. PP

            GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        l+  +l++L  +++E+laVn++++l +l   s    s+++ +Lk v sl P +v++veqe   + ++Fl rf+e+l+y++a+fdsl+  lp 
  XP_009620664.1 266 ---LSGSKLSNLTKRKNETLAVNFIFHLNSLS--SY---SKISYTLKEVHSLCPSIVTIVEQEGCKSPQNFLPRFMESLHYFAAMFDSLDDCLPI 352
                     ...888899*****************999997..33...33558*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrve...........eesgslv 359
                     +s er ++E+  lg+ei+nv+  e+++    r e++e+W+ r+e+ GF  +pls+k+ +qaklll+  + s   +++           e+  ++ 
  XP_009620664.1 353 DSIERLSIEKNHLGKEIKNVLNYEKNNnFLSRYEQMETWKGRMESHGFLGLPLSSKNIMQAKLLLKIRShSSPIQLDggnggfrifetEDPRAIS 447
                     ************************9993469**********************************876644333333444444443534455555 PP

            GRAS 360 lgWkdrpLvsvSaW 373
                     l W+dr++v++SaW
  XP_009620664.1 448 LAWQDRSIVTASAW 461
                     ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.38459430IPR005202Transcription factor GRAS
PfamPF035146.1E-8885461IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGDIVDHEEE LLCLRLAIVT NSCCERKKIK KRKRRELAFI NNWDLNESNY CEGKIFRLLE  60
LREAMLKIDV KKKGSVVEDG KGLHLIHSLL ISATAVDENS IDSAVENLQE LYQNVSLLGD  120
SVQRVAAYFA DGLIARLLTR NSPFYDMIIK LPTQEEEFLA FTEFYKVSPF YQFAHFTSNQ  180
AILEAFEKEE NTNNGFLHVI DFAISYGFQW PSLIQSLSEN ATTSNRISLK ITGYGKTIDE  240
LRETETRLVS FAKGFRNLSF EFQGILSGSK LSNLTKRKNE TLAVNFIFHL NSLSSYSKIS  300
YTLKEVHSLC PSIVTIVEQE GCKSPQNFLP RFMESLHYFA AMFDSLDDCL PIDSIERLSI  360
EKNHLGKEIK NVLNYEKNNN FLSRYEQMET WKGRMESHGF LGLPLSSKNI MQAKLLLKIR  420
SHSSPIQLDG GNGGFRIFET EDPRAISLAW QDRSIVTASA WHCVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-39854624375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12634KKIKKRKRR
22934KKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620664.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_016487626.10.0PREDICTED: scarecrow-like protein 21
TrEMBLK4D6L30.0K4D6L3_SOLLC; Uncharacterized protein
STRINGSolyc11g017100.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123541823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.13e-58SCARECROW-like 21