PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009619922.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 243aa    MW: 27368.6 Da    PI: 5.7089
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009619922.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.39.4e-35460359
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                     + l+cprC stntkfCyynny+ sqPr+fCk+C+r+Wt+GG lrnvPvGggr++++
  XP_009619922.1  4 PEPLNCPRCGSTNTKFCYYNNYNKSQPRHFCKGCKRHWTEGGILRNVPVGGGRKNKR 60
                    6789***********************************************976654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-21160IPR003851Zinc finger, Dof-type
PfamPF027011.5E-30659IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.981761IPR003851Zinc finger, Dof-type
PROSITE patternPS013610945IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MAKPEPLNCP RCGSTNTKFC YYNNYNKSQP RHFCKGCKRH WTEGGILRNV PVGGGRKNKR  60
LKITREKSNS PVVVDDEEKN VFDNLYHELN LPSSSLPHDT ITNNLCLNSP KILSYSCQTL  120
KRCTTSERSD TDPTVFLKSP SNIAKTGVPQ DEDMLLSFSS AIGSSFNKIP CSIPTSADQS  180
SNIYNYMENL DSTMEESTIT WQGPGTSSLM MENMQSYWNW NDIEALVSGD DLNILWDDTE  240
IKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118122TLKRC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619922.10.0PREDICTED: dof zinc finger protein DOF2.5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-28Dof family protein