PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 689aa    MW: 76120.8 Da    PI: 6.8448
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618661.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.41.1e-2973157187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+ aL+++r+em+  +r+++lk+plWeevs+km++ gf+rs+k+Ckek+en+ k++k++k+g+ ++   + +t+++f+qlea
  XP_009618661.1  73 RWPRQETIALLKIRSEMDVVFRDSSLKGPLWEEVSRKMADLGFHRSAKKCKEKFENVYKYHKRTKDGRASK--ADGKTYRFFEQLEA 157
                     8********************************************************************96..66678*******85 PP

2trihelix103.81.3e-32491576187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r++++ +++++  k+plWee+s+ m++ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  XP_009618661.1 491 RWPKAEVEALIKLRTQLDVKYQENGPKGPLWEEISAGMKKLGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 576
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002170132IPR001005SANT/Myb domain
PfamPF138374.8E-1972158No hitNo description
CDDcd122034.24E-2672137No hitNo description
PROSITE profilePS500906.88872130IPR017877Myb-like domain
PROSITE profilePS500907.468484548IPR017877Myb-like domain
SMARTSM007176.3E-5488550IPR001005SANT/Myb domain
PfamPF138378.4E-23490577No hitNo description
CDDcd122033.20E-29490555No hitNo description
Gene3DG3DSA:1.10.10.609.1E-5490547IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MLGVSGIISS TNSGGDGAGG ENPESGGGAA SGGSSEIALG GGAISISGGF MTEEDRAIRN  60
MEEGERNSGG GNRWPRQETI ALLKIRSEMD VVFRDSSLKG PLWEEVSRKM ADLGFHRSAK  120
KCKEKFENVY KYHKRTKDGR ASKADGKTYR FFEQLEALEN NPSSHHSLLP PAMTSSRPPP  180
PPLEATPINM AMPMPSGNAN TINLQLPTSQ QGTTTVTVSS APPNNSNILV SCHQNTTSHQ  240
NIPLSSSMAP SSQPSPQPAN NPINNLQANT NFPSHQNISA MSYSTSSSTS SDEDIQRRHK  300
KKRKWKDFFE RLMKDVIDKQ EDLQRRFLET LEKRERDRTV REEAWRVQEV ARMNREHDLL  360
VQERSMAAAK DAAVISFLQK ITEQQNIQIP SNINVAPPSA QVQIQLPKNP PPPPTRSQVL  420
QQQTQSTILV SPAPPQQSPA TPAPISLPVT IPAAVPAQSL PLTPPVPAKN VELTPKSDNG  480
GEGYTPASSS RWPKAEVEAL IKLRTQLDVK YQENGPKGPL WEEISAGMKK LGYNRNAKRC  540
KEKWENINKY FKKVKESNKK RPEDSKTCPY FHQLDALYKE KAKNETSSSS FSNPSASGFA  600
LNPENNPMMP IMARPEQQWP LPPHHQQHHE STRMDHDHES DNMDQDEDEE DEEDEDEENA  660
YEIVANKQQS SMAAANTATT TTATATTTV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295302QRRHKKKR
2295303QRRHKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618661.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A1S3XDN40.0A0A1S3XDN4_TOBAC; trihelix transcription factor GTL1-like
STRINGXP_009618661.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-57Trihelix family protein