PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 355aa    MW: 38592.2 Da    PI: 8.4032
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-392786362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    e +l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  XP_009617835.1 27 EPSLNCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 86
                    56789****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-271884IPR003851Zinc finger, Dof-type
PfamPF027013.6E-332984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4223084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMSPDNKEES QNSGGGGRKT SAARPQEPSL NCPRCDSPNT KFCYYNNYSL SQPRHFCKTC  60
RRYWTKGGAL RNVPIGGGCR KNKKIKTSSS SRLSGDSKDT SVSSDIGGLK FFHGLSPAMD  120
FQLGGLNFPR LSSNTSTSGS IFNQFSSFGD ISTTSAAAIR SSSCFSLDPS GSCSGSLLGF  180
NNFPFATSML KQGNTGVQEM GSMGDHHGTM ASSIESLSSI NQDLHWKLQQ QRLAMLFGGN  240
QNQKENIVSS HVPHLDQNQV QKQQPILFQN LDISSKQQEE EAAVFGNNIN SRKDHGSGSD  300
HGNNNLATEW FFDNSFGTVN PTSTNSSSGN ANDQNNNNWN SIQAWSNLNQ YSTLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754506e-51HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617835.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A1U7WJ670.0A0A1U7WJ67_NICSY; dof zinc finger protein DOF5.7
STRINGXP_009617835.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-53Dof family protein