PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616343.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 582aa    MW: 64847.1 Da    PI: 6.3098
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616343.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS413.61.8e-1262125811373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+++++++l   + l+++ + ++s +gdp+qRl ay++e+L ar   s++++y++l+++e +     + l+++++++e++P+lkf++
  XP_009616343.1 212 LKQLLIACARVLADNKLDDFEVLVTKARSTVSITGDPIQRLGAYIVEGLVARKELSGTTIYRSLRCKEPA---GNDLLSYMHILYEICPYLKFGY 303
                     689***************************************************9**************9...99******************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++aN aI ea  +e+ vHiiDf+i qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  + + l ++++rL+ + e++++ +efn+ v     +
  XP_009616343.1 304 MAANGAIAEACRNENYVHIIDFQIAQGTQWMTLLQALAARPGGAPYVRITGIDDPVSQyaRGDGLAAVEKRLSAISEKFNIAVEFNA-VPVFAPE 397
                     *******************************************************999999**************************.6888899 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++  +L+v+pgEa+aVn+ lqlh+++desv+++++rde+++++ksl Pk+v++veqe+++n+++F+ rfleal+yy a+f+s++++l+r+ +eri
  XP_009616343.1 398 VTKAMLDVRPGEAVAVNFPLQLHHTPDESVDVNNPRDELIRMIKSLCPKIVTLVEQESNTNTAPFFPRFLEALDYYHAMFESIDVTLARDRKERI 492
                     99********************************************************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +vE+++l+r+ivnv+aceg+er+erhe l+kW++r+++aGF+++pls+++++ +k l+r+++ + y++ e++g+++lgWk+r+L+s+SaW
  XP_009616343.1 493 NVEQHCLARDIVNVIACEGKERVERHELLGKWKSRFMMAGFRQYPLSSYVNSVIKDLMRRYS-EHYTLVEKDGAMLLGWKERNLISASAW 581
                     **************************************************************.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.865186563IPR005202Transcription factor GRAS
PfamPF035146.2E-124212581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDAHHFYDYG VTGSDLSYSS YPTISSLPNR PSGTSKFDSE NSPISPLANY FDSETFTTLS  60
NCQEQHSSTE NLSGASSSSN SSLDYNNYFH RPSSSPDCLP EGLLVFSGGN AVLQNAVHSQ  120
NMQHALLQLE SALMGPDEEV TKSSPSYGGN RAAQTSNQRS RAWTNESKVL HQNETQRSQI  180
SLFAKSGNGI RSQEQNKVLD NLPLHGLPSS NLKQLLIACA RVLADNKLDD FEVLVTKARS  240
TVSITGDPIQ RLGAYIVEGL VARKELSGTT IYRSLRCKEP AGNDLLSYMH ILYEICPYLK  300
FGYMAANGAI AEACRNENYV HIIDFQIAQG TQWMTLLQAL AARPGGAPYV RITGIDDPVS  360
QYARGDGLAA VEKRLSAISE KFNIAVEFNA VPVFAPEVTK AMLDVRPGEA VAVNFPLQLH  420
HTPDESVDVN NPRDELIRMI KSLCPKIVTL VEQESNTNTA PFFPRFLEAL DYYHAMFESI  480
DVTLARDRKE RINVEQHCLA RDIVNVIACE GKERVERHEL LGKWKSRFMM AGFRQYPLSS  540
YVNSVIKDLM RRYSEHYTLV EKDGAMLLGW KERNLISASA WY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-632095811374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7676600.0KJ767660.1 Nicotiana tabacum GRAS2 protein (GRAS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616343.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A076FN020.0A0A076FN02_TOBAC; GRAS2 protein
STRINGPGSC0003DMT4000561200.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-176GRAS family protein