PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 584aa    MW: 65910.7 Da    PI: 4.8484
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616214.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.82.3e-902145821374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalklfsevsPilkf 93 
                     lv+lLl++Ae v++++++la++ +ar    as +g+p+qRl +yf eAL++r+ r++ + + ++  + +  s+    ++  al+  +   P+ ++
  XP_009616214.1 214 LVHLLLAAAEEVDQQQFHLASQSIARCLWKASVTGNPIQRLCFYFGEALQERIDRET-GRSPSFerKLRVLSTLALGTTPEALT-CHTEIPFSQV 306
                     68*****************************************************22.22222201222222222333333333.55667***** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +++  qaI e v+g++++H +Df+i  G+Q   L+qaLa++   +   l+iT++g+   ++ke++eetg+rL++fA++l++pf+f+++ +++++
  XP_009616214.1 307 MQFAGVQAIIENVKGATKIHLVDFNIRTGIQCTGLMQALAEQCdCPIELLKITAIGH---QEKEKIEETGKRLQNFANSLNLPFSFDIVFMSDMK 398
                     ****************************************998345559********...579******************************** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     dl+ e+ +vk +E++aV +   l ++     + +++ d++++++++l+P vvvv+e ea+hns+sFl+rf+eal +y +lfd++e  + r++ +r
  XP_009616214.1 399 DLRAESVNVKADETVAVYCNAVLRTMI----CRPEYMDNTIRVIRGLRPSVVVVCEVEANHNSPSFLNRFVEALFFYGVLFDCFEDCMDRDNLAR 489
                     *************************99....56666667******************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l++++ +   +v+++ ++l+ gWk+ ++ svS W+
  XP_009616214.1 490 KRIEVFHIGEGIRNMVAAEGAERFTRNMKLDVWRAYFARFGMVEMELSESSWYQANLILKQFSqGSSCNVQNDGKALLVGWKGTAIESVSIWK 582
                     ***************************************************************88889************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.512188561IPR005202Transcription factor GRAS
PfamPF035147.9E-88214582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MDQVSIPAID FSVFQAGHNH LQECVRDELV NDGVIDPLFE LDSEDLDSLY SVFDLKYQEN  60
TSDKHVQLSE DQQQNISGYC TQSDDSSSNT DFPLQPVQIQ STFEASNRIQ PQVPRLGNFH  120
GEKTNPISSA SLELLNNCGR LFKKSSEENL SNVHINEAHV GNIPKLSTEE ILRVAGERYI  180
QYSTQRVDGL SMFIHPYASA LSGLSIEQTR DMELVHLLLA AAEEVDQQQF HLASQSIARC  240
LWKASVTGNP IQRLCFYFGE ALQERIDRET GRSPSFERKL RVLSTLALGT TPEALTCHTE  300
IPFSQVMQFA GVQAIIENVK GATKIHLVDF NIRTGIQCTG LMQALAEQCD CPIELLKITA  360
IGHQEKEKIE ETGKRLQNFA NSLNLPFSFD IVFMSDMKDL RAESVNVKAD ETVAVYCNAV  420
LRTMICRPEY MDNTIRVIRG LRPSVVVVCE VEANHNSPSF LNRFVEALFF YGVLFDCFED  480
CMDRDNLARK RIEVFHIGEG IRNMVAAEGA ERFTRNMKLD VWRAYFARFG MVEMELSESS  540
WYQANLILKQ FSQGSSCNVQ NDGKALLVGW KGTAIESVSI WKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-4223258221375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616214.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016477658.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AB560.0M1AB56_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000187920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.17e-48RGA-like 1