PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615228.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 813aa    MW: 88707 Da    PI: 6.404
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615228.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4132.7e-1264357942374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs+++le+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+alp+s+ +   +++ ++a+++f+ +sP++kfsh+
  XP_009615228.1 435 LTLLLQCAEAVSADNLEEANKMLLEVSELSTPFGTSAQRVAAYFSEAISARLLNSCLGIYAALPVSSIPVLYTQKMASAFQVFNGISPFIKFSHF 529
                     579*****************************************************************9999*********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s ++le+tg+rL++fAe+lg+pfef + va+++ +l++
  XP_009615228.1 530 TANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPFVRLTGLGT----SMDALEATGKRLSDFAERLGLPFEFLP-VADKVGNLQP 619
                     *****************************************************....***************************.7********* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a +++eseer++vE
  XP_009615228.1 620 EKLNVSKREAVAVHWLQ--HSLYDVTGSDSN----TLSLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGACYGEESEERHVVE 707
                     ****************9..999999999999....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll++ei+nv+a  g +r  + + +++Wre+l+++GF++++l  +aa+qa lll +++s+gy++ e++g+l lgWkd  L+++SaWr
  XP_009615228.1 708 QQLLSKEIRNVLAVGGPSRSGEVK-FNNWREKLQQSGFRSISLAGNAAAQATLLLGMFPSHGYTLVEDNGTLKLGWKDLCLFTASAWR 794
                     ******************888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.675408774IPR005202Transcription factor GRAS
PfamPF035149.3E-124435794IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MAKALPPNGD NWGNTSANVG GSSDKDNSKM VRKRAASDME IQSGAGEENR YLRRPVTIGG  60
SHSQLGDFRA CGTSNLGHVS NYSTMQMLPS STNVCGVTSK GADFTGFSNS IPNLTNYTDA  120
ITSSHHIQPQ NHNNNNQSPS VCVFSGLPLF PPDRNRQNGG VLLQQQPATA AAVLASPLTT  180
TAASMEESAT SATAWIDGII KDLINSSAQV SVPQLIQNVR EIIHPCNPYL ASLLEYRLRS  240
LTSNNNNNNN NSNNNNNGAS ADVQNDAAAM EFWRRKEGVL PQLASLQHGQ NLNPILLQHN  300
NILSIPDSSN NHYLNWDIAA PVAPSLNQHQ QISSNNNPTA TADLSFVTSP PILSPQLQQQ  360
QQQQQQESSH SQQQVAIDLE QQKQQQSSST SLSPTSATES GKTKTTTPVV PVNTYREKKE  420
EERQQKRDED GLHLLTLLLQ CAEAVSADNL EEANKMLLEV SELSTPFGTS AQRVAAYFSE  480
AISARLLNSC LGIYAALPVS SIPVLYTQKM ASAFQVFNGI SPFIKFSHFT ANQAIQEAFE  540
REDRVHIIDL DIMQGLQWPG LFHILASRPG GPPFVRLTGL GTSMDALEAT GKRLSDFAER  600
LGLPFEFLPV ADKVGNLQPE KLNVSKREAV AVHWLQHSLY DVTGSDSNTL SLLQRLAPKV  660
VTVVEQDLSH AGSFLGRFVE AIHYYSALFD SLGACYGEES EERHVVEQQL LSKEIRNVLA  720
VGGPSRSGEV KFNNWREKLQ QSGFRSISLA GNAAAQATLL LGMFPSHGYT LVEDNGTLKL  780
GWKDLCLFTA SAWRPNSFHT SPASRHFSRP NMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-494347944375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615228.10.0PREDICTED: protein SCARECROW-like
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLK4D1R00.0K4D1R0_SOLLC; Uncharacterized protein
STRINGSolyc10g074680.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82582430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein