PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009614985.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 659aa    MW: 73992.6 Da    PI: 6.665
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009614985.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-094614981954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps++++  L++++gL+++qV++WF N R +
  XP_009614985.1 461 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 498
                     554459******************************88 PP

2BELL108.15.3e-35321392172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er e q++k kLls+l+eVd rY +y+eq+q++++sF+ ++g+g+a+pYt+lA+ka+SrhFrc+kdai+ q+
  XP_009614985.1 321 ERCEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSMIGYGAAAPYTALAQKAMSRHFRCIKDAIVAQL 392
                     67899****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-57256390IPR006563POX domain
PfamPF075262.0E-48261389IPR006563POX domain
PROSITE profilePS5007112.422439502IPR001356Homeobox domain
SMARTSM003891.8E-9442506IPR001356Homeobox domain
CDDcd000869.88E-12442503No hitNo description
SuperFamilySSF466896.42E-17443509IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28445508IPR009057Homeodomain-like
PfamPF059207.2E-18459498IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MSQSFQQGFY NFSSVYERSV TKHEDMLRVQ GFEPVLPPPP PQQVEEPPGA VYDGGGMLTE  60
IISYPSAWRK AATEILDDQI QSSNYRPWPQ KEQQQQLPPA INEAELPLMN SHIKALSPPR  120
SSSSLHMLLP NSADTNSLLH QQGFHLLNSA TVEPPSQFTW VPGSSSGEDN STRIGRIVDG  180
QGLSLSLSRN FEAAAKLEDL RIGNGGIYLN NNQGLFGPIN NNNNQHQLLH SGVVMDHHTT  240
LHSNHQVHVG YAAASPRMTN VLRNSRYVKA AQELLEEFCC VGRGNFKNQR VKKYEDENPN  300
SNTESEDRGS SKDHPPLSAA ERCEYQRRKI KLLSMLDEVD ARYTRYCEQM QAMVNSFDSM  360
IGYGAAAPYT ALAQKAMSRH FRCIKDAIVA QLKQTCKYLG EKDVTGSGGL TKGETPRLKM  420
LDQKLRQQKA LHQMGMLDSD AWRPQRGLPE RSVNVLRAWL FEHFLHPYPS EADKHLLSRQ  480
TGLSKNQVSN WFINARVRLW KPMVEEMYQQ ETKEVETDQD QEEEEQEKQL SAQTSMHDKI  540
SNMATSATTT TMPLSVRSEF NANERDPSKN IINYRQYALG NQLIMLQDDT ATGSSATHDV  600
STTVNHYFTA ADAADLVANS NTAFGSQPAG DVSLTLGLRH SENVPRKTTQ FQLRDFGAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16448506563Homeobox protein Meis2
3k2a_B1e-16448506563Homeobox protein Meis2
4xrm_A2e-16448506563Homeobox protein Meis2
4xrm_B2e-16448506563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-104HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankCU4590251e-104CU459025.8 S.lycopersicum DNA sequence from clone LE_HBa-223O22 on chromosome 4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614985.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-133BEL1-like homeodomain 2