PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009614056.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 637aa    MW: 69982.7 Da    PI: 6.9692
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009614056.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.86.9e-1062706373374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + ++e+A+a+s+g ++ a ++L+rls+ ++ +g+++qR +ay++ AL++r++     +    p+ e    + +e++ +++ +++vsP++k+++++
  XP_009614056.1 270 QSITEAATAISEGINHVAVEILTRLSQVSNVRGSSIQRSTAYMVSALRSRVNP----TDYPPPVLEL---HNKEHTVSTQNLYDVSPCFKLGFMA 357
                     67899***********************************************9....2222233333...47888899999************** PP

            GRAS  98 aNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     aN aIleav  +  +++H+iDfd++qG+Q++ Ll+aLa+++ e+p+ l+iT++ ++  g  ++l+++g  L+  A+++gv + fnv +a +++dl
  XP_009614056.1 358 ANLAILEAVTDHptNKIHVIDFDVGQGGQYLHLLHALAAKKsEKPAVLKITAFTEQVGGVDDRLNSIGVELTAEANKVGVCLYFNV-MACKITDL 451
                     ***********9999***********************77737777*********8888**************************9.7999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     + e+L ++p+EalaVn++++l+rl+desv++e+ rde+L+ vk+lsPkvv+vveqe++ n+++Fl+r+ ea+ yy alfdsl+a+++r++ er+ 
  XP_009614056.1 452 SREKLGLEPDEALAVNFAFKLYRLPDESVTTENLRDELLRRVKGLSPKVVTVVEQELNGNTAPFLARVNEACGYYGALFDSLDATVSRDKLERVR 546
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +E+  l+r+  n vaceg++r+er+e ++kWr+r+++aGF + p+s+ +a++  + l+     + g++v+e+sg +++gW++r+L+++SaWr
  XP_009614056.1 547 IEEG-LSRKMANSVACEGRDRVERCEVFGKWRARMSMAGFVQRPMSQLVANSLCSKLNSGTrgNPGFTVNEQSGGICFGWMGRTLTVASAWR 637
                     ****.******************************************9999887777654437999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.104242615IPR005202Transcription factor GRAS
PfamPF035142.4E-103270637IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MSSGFPGDFY GAGGINTGRS TMNNNTLRSQ LSGILPDPAT QIVLGRPNLM GKRSLAEFQQ  60
QQQFQFLQQQ QQNQQQQMIL QQQQQQQGLG FYLRNVKPRS YQQASPVDFS AVAISSISSE  120
FSSFSSNSNA STMNTRHTLP VLQQLRSQPA LPLANTNISG FSHPGTQTYS TGVYNRATIG  180
QELLSQESEK KMMNQLQELE KQLLDDNDEE DGDTVSVVTN NEWLQNLISP CQSQNQNQNQ  240
NQKLASLSPS SSTSSCASST ESPPISCPKQ SITEAATAIS EGINHVAVEI LTRLSQVSNV  300
RGSSIQRSTA YMVSALRSRV NPTDYPPPVL ELHNKEHTVS TQNLYDVSPC FKLGFMAANL  360
AILEAVTDHP TNKIHVIDFD VGQGGQYLHL LHALAAKKSE KPAVLKITAF TEQVGGVDDR  420
LNSIGVELTA EANKVGVCLY FNVMACKITD LSREKLGLEP DEALAVNFAF KLYRLPDESV  480
TTENLRDELL RRVKGLSPKV VTVVEQELNG NTAPFLARVN EACGYYGALF DSLDATVSRD  540
KLERVRIEEG LSRKMANSVA CEGRDRVERC EVFGKWRARM SMAGFVQRPM SQLVANSLCS  600
KLNSGTRGNP GFTVNEQSGG ICFGWMGRTL TVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-412656379375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7302480.0KJ730248.1 Nicotiana tabacum GRAS10 protein (GRAS10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614056.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A075F2G50.0A0A075F2G5_TOBAC; GRAS10 protein
STRINGPGSC0003DMT4000262400.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40232443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-137SCARECROW-like 8