PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 635aa    MW: 72360.8 Da    PI: 6.5155
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612535.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.58e-1092576302374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     + lL++cA+a+ss d++ a++lL r+++++s++gd ++Rla+y+++AL+arl+++++  y a+++s+ s    ++ l+a+k+f  ++P+  +s++
  XP_009612535.1 257 RGLLTQCAQAMSSYDTRTANELLLRIRQHSSSHGDETERLAHYLANALEARLSGTGTASYTAFASSRIS---AAHILKAYKAFITACPFKLMSNI 348
                     679***************************************************999999999888888...999******************** PP

            GRAS  97 taNqaIleavege..ervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      aN+ I + + g   +++HiiDf+i +G+QWp+L+q+L+  R ++p +lRiTgv+ p++g   +e++e tg+rL+k++++++vpfef + +ak++
  XP_009612535.1 349 FANKYIKKLITGGapRTIHIIDFGILYGFQWPCLIQSLSaLRHGEPIKLRITGVELPQPGfrPAERVEDTGRRLKKYCDRFNVPFEFIA-IAKKW 442
                     **********998899**********************967778888************9*****************************.7**** PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     e+++leeL+++++++l+Vn+ ++l +++de+v  +s+rd vL+l+++++P+++++   +  +n++ Fl+rf eal ++s+lfd++ea+lpre+e+
  XP_009612535.1 443 ESITLEELQIDRNDVLVVNSLYRLGNIPDETVVPTSPRDVVLDLIRRIRPDMFIHGVVNGTYNTPFFLTRFREALFHFSTLFDMFEATLPREDED 537
                     *********************************************************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+  E+e+++r+++nv+aceg+er+er et+++W+ r  +aGF+++pl++++++ ++  +r+ + + ++v+e+++++++gWk+r ++++S+W+
  XP_009612535.1 538 RKLFEEEVFARDAMNVIACEGTERVERPETYKQWQLRCARAGFRQLPLDQEIVNFVSNKVRREYHKDFSVDEDRQWMLQGWKGRVVYALSCWK 630
                     ***************************************************************9888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.353230610IPR005202Transcription factor GRAS
PfamPF035142.8E-106257630IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MEAIFQEQLF PGADAFIFRH PSSREDVVVQ NGSTIFNRPS FEDYPYVLSN VREGDSSPKE  60
EGEGERDYSD AMYKYISQML MEEEDLEYKP CMFRDCMALQ AAEKYFSDVL HGSENITISP  120
QFSAIIPQDK VSSSCPDLSN TSSYSIESPQ SGLNFESPVS VKSLPDVSNG LNHGSSGLRE  180
KKNHHRQDDD HQRSNKQLAT FAADESEPLE MYDNVLLLCP NNPCGPPNEV KKPTKVGRSR  240
SGGKKHSSSK KEIVDLRGLL TQCAQAMSSY DTRTANELLL RIRQHSSSHG DETERLAHYL  300
ANALEARLSG TGTASYTAFA SSRISAAHIL KAYKAFITAC PFKLMSNIFA NKYIKKLITG  360
GAPRTIHIID FGILYGFQWP CLIQSLSALR HGEPIKLRIT GVELPQPGFR PAERVEDTGR  420
RLKKYCDRFN VPFEFIAIAK KWESITLEEL QIDRNDVLVV NSLYRLGNIP DETVVPTSPR  480
DVVLDLIRRI RPDMFIHGVV NGTYNTPFFL TRFREALFHF STLFDMFEAT LPREDEDRKL  540
FEEEVFARDA MNVIACEGTE RVERPETYKQ WQLRCARAGF RQLPLDQEIV NFVSNKVRRE  600
YHKDFSVDED RQWMLQGWKG RVVYALSCWK PAQQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402606308375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4499400.0DQ449940.1 Nicotiana tabacum GRAS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612535.10.0PREDICTED: scarecrow-like protein 30
SwissprotQ9SNB81e-174SCL30_ARATH; Scarecrow-like protein 30
TrEMBLQ1PCS00.0Q1PCS0_TOBAC; GRAS1
STRINGSolyc01g100200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-164GRAS family protein