PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611175.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 736aa    MW: 83134 Da    PI: 6.4703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611175.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS392.74e-1203647332374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++ L+ cA+av+++d + a+++L+++++++s+ gd mqRla+y++++L+ar+a+s++++y al + +ts    +++l+a++lf  ++P+ k+s++
  XP_009611175.1 364 RTILTLCAQAVAADDRRTANEFLKQIRQNSSSMGDGMQRLAHYVANGLEARMAGSGTQIYTALISMPTS---AADVLKAYQLFLAACPFRKLSNF 455
                     67899**********************************************************999998...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       N++I++ +e++++vHiiDf+i++G+QWp+++q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rLa++Ae+++vpfef++ +ak++e++
  XP_009611175.1 456 FSNKTIMNVAERAKTVHIIDFGIMYGFQWPCFIQRLSSRPGGPPKLRITGIDFPNPGfrPAERVEETGKRLANYAESFNVPFEFKA-IAKKWETI 549
                     ********************************************************9*****************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++e+L+++++E+l+Vn+ ++  +llde+v  +s+rd vL+l+++l+P+v++    +  +n++ F +rf eal +ys++fd+lea++pre +er+ 
  XP_009611175.1 550 KVEDLEIRKDEVLVVNCLYRFRNLLDETVVANSPRDIVLNLIRTLKPDVFIQGIVNGAYNAPFFITRFREALFHYSSVFDMLEANIPREIHERML 644
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +E+ ++gre++nvvace aer+er et+++W+ r  +aGF+++pl+e+++  ak  ++ +++d + ++ + ++l++gWk+r ++++S W+
  XP_009611175.1 645 IEKIIFGREVMNVVACEAAERIERPETYKQWQVRNIRAGFRQLPLNEEIMRMAKERVKAYHKD-FVIDVDGHWLLQGWKGRIIYALSTWK 733
                     *************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.393337714IPR005202Transcription factor GRAS
PfamPF035141.4E-117364733IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MVMDKNYKGL YEATSAIQIK DEDLSFFPDL NLINNLRVRD HNLVQRNQPD VLVPSAVDNS  60
HEDYDFSDVV LKYISQMLME ENIEEKACMF QESAALQAAE RSFYEVIGEK YPPSSNREMP  120
NLREIEGRYP VDCSSSNYYS CVSDVSDGLL CPNWNPDIGG DSDSSHAQHF PVDGAGASTS  180
QSSHSSPSSS GTVTDAHLDS PVNSIQIPDI FSDSESIMQF KKGVEEASKF LPTGNSLLLD  240
VRYNVVGKED NEYGKNAVVK VENWGKHQSP EGSRGKKNVH HDDVDAMEER SNKQSAVFSE  300
STVRSEMFDR VLLCSGGKNE SALRESWQTV SSKNAPEDGL PKGSNGRKSR GKRQGSKRDT  360
VDLRTILTLC AQAVAADDRR TANEFLKQIR QNSSSMGDGM QRLAHYVANG LEARMAGSGT  420
QIYTALISMP TSAADVLKAY QLFLAACPFR KLSNFFSNKT IMNVAERAKT VHIIDFGIMY  480
GFQWPCFIQR LSSRPGGPPK LRITGIDFPN PGFRPAERVE ETGKRLANYA ESFNVPFEFK  540
AIAKKWETIK VEDLEIRKDE VLVVNCLYRF RNLLDETVVA NSPRDIVLNL IRTLKPDVFI  600
QGIVNGAYNA PFFITRFREA LFHYSSVFDM LEANIPREIH ERMLIEKIIF GREVMNVVAC  660
EAAERIERPE TYKQWQVRNI RAGFRQLPLN EEIMRMAKER VKAYHKDFVI DVDGHWLLQG  720
WKGRIIYALS TWKAAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-473637335375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611175.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009611176.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM1A7D30.0M1A7D3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000162580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14