PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 197aa    MW: 22701.6 Da    PI: 6.414
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611005.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.8e-1483141563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     ++ rr+++NRe+ArrsR RK++ ++eL   v  L +eN+ L+++l++ ++  +k+ +e+
  XP_009611005.1  83 RKKRRMISNRESARRSRMRKQKHLDELWSQVLRLRTENHNLIDKLNQVSDCHDKVLQEN 141
                     6889********************************************99999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.880.106.5E-64497IPR008917Transcription factor, Skn-1-like, DNA-binding domain
SMARTSM003381.2E-1579143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.69181144IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.59E-1283132No hitNo description
PfamPF001707.3E-1383141IPR004827Basic-leucine zipper domain
CDDcd147029.65E-2284135No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-1298155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MIPSEAAAVH YFASENTSPL PLDFNFMHNN LPSLHFSRYL TNLPNYPTTL PVHDFSNMPL  60
SCISGNSTSD EADEQQLRII DERKKRRMIS NRESARRSRM RKQKHLDELW SQVLRLRTEN  120
HNLIDKLNQV SDCHDKVLQE NAQLKEEASD LRQMLTVLQF NSIFPDLCDL EDVPCTTAHL  180
KAESSNLSIT PCTNLLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
182103RKKRRMISNRESARRSRMRKQK
295102RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611005.11e-144PREDICTED: basic leucine zipper 43-like
RefseqXP_016500977.11e-144PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC25e-35BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A1S4CIE31e-143A0A1S4CIE3_TOBAC; basic leucine zipper 43-like
STRINGXP_009611005.11e-144(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-46basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]