PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009609251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 674aa    MW: 74865.1 Da    PI: 5.7702
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009609251.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.33.3e-1282916581373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                     l++lL++cAea+ s++ + +++l+arl +lasp+g +p+ Rl+ayfteALa r+ar ++++++++pp++ + +  +++ +al+l+++vsPi+kf 
  XP_009609251.1 291 LISLLVSCAEAIGSRNVTGVNQLIARLGDLASPRGgSPIIRLTAYFTEALALRVARLWPHIFHIIPPRNLD-RLDDDSSTALRLLNQVSPIPKFI 384
                     5799******************************999********************************98.5678888999************* PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+t N+ +l+a+eg+ervHiiDfdi+qGlQWp+L+q+LasRp++p ++RiTg+g+    sk+ l etg+rLa+fAe+l++ fef++ v++rled+
  XP_009609251.1 385 HFTSNEILLRAFEGKERVHIIDFDIKQGLQWPSLFQSLASRPNPPTHVRITGIGE----SKQDLVETGDRLAEFAEALNLAFEFHP-VVDRLEDV 474
                     *******************************************************....9**************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +l++L+vk+gE++aVn++lq+hrll +s       +++L l++s++P+++ ++eqea+hn++s+ +r++++l+yy+a+fds+  +lp +s  rik
  XP_009609251.1 475 RLWMLHVKEGESVAVNCALQMHRLLYDSSGGIL--RDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYYAAVFDSIGFSLPLDSPSRIK 567
                     ************************966655444..79********************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaW 373
                     +E+  ++r+i+n++aceg++r+erhe ++kWr+ +e+ GF+   ++e++  q ++ll++++ + yrv    +++++l+l W d+pL +vSaW
  XP_009609251.1 568 IEEL-FARDIRNIIACEGRDRTERHECFGKWRKLMEQGGFRCTGITERELLQSQMLLKMYSCEDYRVIkqgNDDAALTLSWLDQPLCTVSAW 658
                     **98.********************************************************888*9984445589999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.173265636IPR005202Transcription factor GRAS
PfamPF035141.1E-125291658IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MLAGCSSTLL SPRHRLRSEA SAQFQACNFP SMSTQRLDLP CSFARKDNQR SQSIRPVGSL  60
SVDKPIETKN SSCSLKQNIR LPPSPTTAQT SSYVEGESKD EYWEKGRSLK RYADQGCFDD  120
ENCISRGAKR KKGNRKSVDC SEEVEGYGLS LGQLGNGNFW LQSGYNVSRS VQAAAPFSFS  180
CSGEEESVCF VPSEVISPPP PLSNNPWIDS VVTEITNFGD KNVSTSQDPA KEASVSSASL  240
DSHGLVLRLN ENPGEHEIGN GSRPPNPNDR SEVVAAHNEH NNHREDDAAE LISLLVSCAE  300
AIGSRNVTGV NQLIARLGDL ASPRGGSPII RLTAYFTEAL ALRVARLWPH IFHIIPPRNL  360
DRLDDDSSTA LRLLNQVSPI PKFIHFTSNE ILLRAFEGKE RVHIIDFDIK QGLQWPSLFQ  420
SLASRPNPPT HVRITGIGES KQDLVETGDR LAEFAEALNL AFEFHPVVDR LEDVRLWMLH  480
VKEGESVAVN CALQMHRLLY DSSGGILRDF LGLIRSTNPT IILMAEQEAE HNEPSLEARL  540
VNSLRYYAAV FDSIGFSLPL DSPSRIKIEE LFARDIRNII ACEGRDRTER HECFGKWRKL  600
MEQGGFRCTG ITERELLQSQ MLLKMYSCED YRVIKQGNDD AALTLSWLDQ PLCTVSAWSP  660
LDAAGSSSSY YQPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-522886581374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
GenBankAP0102630.0AP010263.1 Solanum lycopersicum DNA, chromosome 8, clone: C08SLm0019C20, complete sequence.
GenBankAP0092790.0AP009279.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0197J17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609251.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM0ZTN80.0M0ZTN8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000078790.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein