PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 745aa    MW: 84310.5 Da    PI: 6.4677
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607977.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS388.48e-1193727421374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+av++++ + a++lL+++++ +sp gd mqRla+yf+++L+ar+a+s++++ykal +++ s    +++l+ ++l+  ++P+ k+s+
  XP_009607977.1 372 LRTLLTLCAQAVAAENRRTANELLKEIRQGSSPMGDGMQRLAHYFANGLEARMAGSGTHIYKALITRPVS---AADVLKGYQLLLAACPFRKISN 463
                     5789***************************************************************999...99******************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +  N+aI++ +e++++vHiiD++i+ G+QWpaL+q L+sRp+gpp+lRiTg++ p++g   + ++eetg+rL+++Ae+++vpfefn+ +a+++e+
  XP_009607977.1 464 FFSNKAIMNLAENDSTVHIIDIGIMWGFQWPALIQRLSSRPGGPPKLRITGIDFPHPGfrPAVRVEETGRRLTNYAERFNVPFEFNA-IAQKWET 557
                     ********************************************************9999***************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L++++gE+l+Vn+ ++  +llde+v+++s+rd vL+l+++l+P+v+++   +  +n++ F +rf eal +ys+lfd+lea++pre +er+
  XP_009607977.1 558 IKLEDLKINKGEVLVVNCLYRFRNLLDETVDVNSPRDVVLNLIRKLNPDVFILGIVNGAYNAPFFITRFREALFHYSSLFDMLEANIPREVHERM 652
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +E+ +lgre++nv+ace+aer+er et+++W+ r+++aGF+++pl+e+++  a    + ++++ + ++ +s++l+ gWk+r  +++S W+
  XP_009607977.1 653 LIEKNILGREAMNVIACETAERIERPETYKQWQVRIMKAGFRQLPLDEEIMRMATERFKVYDKN-FVIDVDSEWLLHGWKGRIGYALSTWK 742
                     **********************************************************999966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.426346723IPR005202Transcription factor GRAS
PfamPF035142.8E-116372742IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MGLYEAGCAI KLEDEAHSFF PDPNLINNLR VNDNLVNRNH VDISPFQSNT LVPSTADEDY  60
DFSDVVLKYI NQMLMEEDIE EMSCMFQESA ALRAAEQSFY EVIGEEYPSP PIVEKPSNLG  120
QNGHYTRETS HFYYSGNDGC DGIPCPNWNL DLGGDDVPYV SHFPDGVALR STSWSPHSSS  180
STVTDVPVDS PVSTLRIPDI FSDRESIMQF KKGVEEASKF IPRGNSLFAD VRYNAVGNEQ  240
NEERKDAVVK VAKYGEKQSP ERSRGKKNTL QEDVVDSMEE RNNKQSAVFY ESTVRSEMFD  300
RVLLCNAGKD ESALRETWQT ISRRNALENG VSKGSNGKKS QGKKQGGKRN VVDLSKNSQA  360
KKQGGKRDVV DLRTLLTLCA QAVAAENRRT ANELLKEIRQ GSSPMGDGMQ RLAHYFANGL  420
EARMAGSGTH IYKALITRPV SAADVLKGYQ LLLAACPFRK ISNFFSNKAI MNLAENDSTV  480
HIIDIGIMWG FQWPALIQRL SSRPGGPPKL RITGIDFPHP GFRPAVRVEE TGRRLTNYAE  540
RFNVPFEFNA IAQKWETIKL EDLKINKGEV LVVNCLYRFR NLLDETVDVN SPRDVVLNLI  600
RKLNPDVFIL GIVNGAYNAP FFITRFREAL FHYSSLFDML EANIPREVHE RMLIEKNILG  660
REAMNVIACE TAERIERPET YKQWQVRIMK AGFRQLPLDE EIMRMATERF KVYDKNFVID  720
VDSEWLLHGW KGRIGYALST WKAAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-463727425375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607979.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009607978.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009607977.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009607976.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009607975.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009607974.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM1CLG20.0M1CLG2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000699490.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14