PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 453aa    MW: 51024.3 Da    PI: 5.5938
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3069.1e-94574502373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfsh 95 
                     ++lL++cA+a++s+d +laq++L+ l+++a pdgd++qRl+  f++AL  r a+   +++k l+++ +++++ ++ ++  l  f++++P+++f++
  XP_009607182.1  57 EQLLVHCANAIESNDPTLAQQILWVLNNIAPPDGDSNQRLTCGFLRALIVRAAK--IGTCKLLTANLNHSMEtHKFSIIELAGFVDLTPWHRFGF 149
                     79****************************************************..667777766666554424455555555************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl...... 181
                      +aN aIleaveg + vHi+Df++++++Q p+L++a+++R egpp +++T+ g+ e        ++ee+g +L +fA++ +v +ef+v+      
  XP_009607182.1 150 TAANGAILEAVEGYSIVHIVDFSLTHCMQIPTLIDAISTRLEGPPLVKLTVAGATEDLppmLDLSYEELGAKLVNFARSRNVMMEFRVIpssssd 244
                     ******************************************************776698888999**********************9776333 PP

            GRAS 182 .vakrledleleeLrvkp......gEalaVnlvlqlhrll..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                           +++ +e+Lrv++      gEal++n++++lh+++              +++ s++s r+ +Lk++++l P++vv+v+++ad +s++++ 
  XP_009607182.1 245 gF----SNV-IEQLRVQNlirpenGEALVINCHMMLHYIPeettvlsprfpldqSSNSSISSFRSMFLKAIRNLDPTIVVLVDEDADFTSNNLVC 334
                     33....333.66666666666678****************************976677778899******************************* PP

            GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                     r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r er e +++W +r+++a F++  +se+ ++++k +l +++  g+ 
  XP_009607182.1 335 RLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGLQRLERLEPKNQWVQRMRNANFRSSGFSEDSVSEVKNMLDEHA-AGWG 427
                     *********************************.********************************************************.999* PP

            GRAS 351 veeesgslvlgWkdrpLvsvSaW 373
                     ++ +++ +vl+Wk++++v+++aW
  XP_009607182.1 428 LKRDEEDVVLTWKGHNVVFATAW 450
                     *********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.61230432IPR005202Transcription factor GRAS
PfamPF035143.2E-9157450IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MMQFTESLPP SLHQQVSPIF SSLMLNKNDN QIQRARPWPG FPTSKNLGTI GDANCMEQLL  60
VHCANAIESN DPTLAQQILW VLNNIAPPDG DSNQRLTCGF LRALIVRAAK IGTCKLLTAN  120
LNHSMETHKF SIIELAGFVD LTPWHRFGFT AANGAILEAV EGYSIVHIVD FSLTHCMQIP  180
TLIDAISTRL EGPPLVKLTV AGATEDLPPM LDLSYEELGA KLVNFARSRN VMMEFRVIPS  240
SSSDGFSNVI EQLRVQNLIR PENGEALVIN CHMMLHYIPE ETTVLSPRFP LDQSSNSSIS  300
SFRSMFLKAI RNLDPTIVVL VDEDADFTSN NLVCRLRSAF NYLWIPYDTV DTFLPRGSKQ  360
RQWYEADICW KIENVIAHEG LQRLERLEPK NQWVQRMRNA NFRSSGFSED SVSEVKNMLD  420
EHAAGWGLKR DEEDVVLTWK GHNVVFATAW VPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-18584506374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607182.10.0PREDICTED: scarecrow-like protein 32
RefseqXP_016433002.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-180SCL32_ARATH; Scarecrow-like protein 32
TrEMBLK4BD530.0K4BD53_SOLLC; Uncharacterized protein
STRINGSolyc02g092570.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87812429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-179GRAS family protein