PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 698aa    MW: 78792 Da    PI: 6.0746
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607088.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.81.1e-1073216942374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL++cAeav+s + +   ++L+++++++sp gdp+ Rla +f++AL+ar a+   +  +++++ ++s  + ++ l+a++++  ++P+ ++s++
  XP_009607088.1 321 TSLLTRCAEAVASYNSKTFVEVLSKIRQHSSPFGDPTARLAYCFANALEARFAG---GGGDTITTPKKSILSAADFLKAFQVYITACPFKRMSNI 412
                     689***************************************************...4444455555555569********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN+ I + ++++ ++HiiDf+i +G+QWp++++ ++ Rp+gpp+l+iTg++ p++g   +e++eetg+rL+++++++gvpfe+++ +ak+++d+
  XP_009607088.1 413 FANKSIAKLTNEAPKIHIIDFGILYGFQWPCIIHGISLRPGGPPKLKITGIDFPQPGfrPAERVEETGRRLENYCKRFGVPFEYKA-IAKKWDDI 506
                     ********************************************************9*****************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     +le+L ++++E+++Vn+ ++l++++de+v ++    +r++vLkl+k+++P+ +v+   +a +n++ F +rf eal ++s+ fd++ea++ re+e 
  XP_009607088.1 507 KLEDLIIEQDETVVVNCLYRLKNVPDETVLSHGsnsPRNAVLKLIKEINPHWFVHGIVNAMYNASFFTTRFREALFHFSSQFDMFEATMTREDEG 601
                     **************************98755433459********************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+  E+e++gr+i+nv+aceg+er+er e++++W+ r + aGF+++pl+++++k++k+ +r+++ + + v+e+s+++++gWk+r ++++S+W+
  XP_009607088.1 602 RMIFEQEVFGRDIRNVIACEGTERVERPESYKQWSVRNQIAGFRQLPLNQDIVKEVKAKVRMFYHRDFLVDEDSNWMLQGWKGRIMYALSVWQ 694
                     ****************************************************************999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.13294674IPR005202Transcription factor GRAS
PfamPF035143.7E-105321694IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MNTNTYFPSV DHRSSDGLEL CHRFAMTSTN LGNEFSSADH HDVVFFSSSC GTSSNNDNVV  60
VEGGGGCDQT VVESDYFDGV FKYIQQMLLE EDDDLESRPC MFQDCVALQA AEKSFYDALT  120
DNNNNDPTIV EHCSSTDFPV NHAFISTTHC LQDDNFNHFL DQPNLISDFN ASNTGIRGNT  180
PLNNNCQAAA AANGDHRNIY YGVNSPNTNN QGGTSKSEGK KKHNREECGE SSNGPNSKQF  240
ASNGTEETEE QTHEEYYDKA LLCPDMNPAF YVEDSCDDGS RSSSENVAWD KQKSRHIKQS  300
KRGRPRGSKK GVKTNEVVDL TSLLTRCAEA VASYNSKTFV EVLSKIRQHS SPFGDPTARL  360
AYCFANALEA RFAGGGGDTI TTPKKSILSA ADFLKAFQVY ITACPFKRMS NIFANKSIAK  420
LTNEAPKIHI IDFGILYGFQ WPCIIHGISL RPGGPPKLKI TGIDFPQPGF RPAERVEETG  480
RRLENYCKRF GVPFEYKAIA KKWDDIKLED LIIEQDETVV VNCLYRLKNV PDETVLSHGS  540
NSPRNAVLKL IKEINPHWFV HGIVNAMYNA SFFTTRFREA LFHFSSQFDM FEATMTREDE  600
GRMIFEQEVF GRDIRNVIAC EGTERVERPE SYKQWSVRNQ IAGFRQLPLN QDIVKEVKAK  660
VRMFYHRDFL VDEDSNWMLQ GWKGRIMYAL SVWQPIHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-493206945375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607088.10.0PREDICTED: scarecrow-like protein 30
TrEMBLM1CZT40.0M1CZT4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000782860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-155SCARECROW-like 14