PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 748aa    MW: 84443.4 Da    PI: 5.5526
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.93.4e-1133747451373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+ v+++d + a++ L+++++++sp+gd+ qRla++f+ +L+arla+++++ y+al+p++ +    +e+l+a++++   +P+ k+s 
  XP_009606498.1 374 LRTLLISCAQSVAADDRRTANEQLKQIRQHSSPTGDAYQRLASVFADGLEARLAGTGTQQYAALAPKRIT---AAEKLKAYQVYLSSCPFKKISI 465
                     6789*************************************************************99999...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     l aN++I   +++++++H iDf+i++G+QWp L+q L++ p+gpp+lRiTg++ p++g   +e+le+tg+rLak++e+++vpfe+n+++++++e+
  XP_009606498.1 466 LFANKMIFHTASNARTLHLIDFGITYGFQWPILIQLLSQIPSGPPKLRITGIDLPQPGfrPAESLEQTGSRLAKYCERFHVPFEYNAIATQNWEN 560
                     *********************************************************9******************************999**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L++ +gE++aVn+ ++l++llde+v ++s+rd+vL+l+++++P+++v +  + +++++ F++rf eal +ys+lfd+++a+lpr++++r 
  XP_009606498.1 561 IKIEDLKLASGETVAVNCLFRLKNLLDETVVVDSPRDAVLSLIRKMNPDIFVQAVVNGSYSAPFFVTRFREALFHYSTLFDMFDATLPRDDQQRL 655
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       E+e+ +re++nv+aceg+er+er et+++W+ r ++aGFk +pl+++ +++ ++ ++  + + +  +e+ +++++gWk+r + + S+W
  XP_009606498.1 656 HFEQEFYRREAMNVIACEGSERVERPETYKQWQVRNMRAGFKLLPLNQQLMQKLRCKVKGGYHRDFVFDEDGNWMLQGWKGRVVCASSCW 745
                     **************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.769348726IPR005202Transcription factor GRAS
PfamPF035141.2E-110374745IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MDPRFNPLPH PVNTFEFEDQ INLSSFEESL NHPLSYTNDY VAFGAPYNTS SPDVGNFAPS  60
SNVSSEVDSP DDHDSDSLFK YLNQILMEEN IEDKPSMFHD PLALKAAEKS FYEALGKSYP  120
PSPYRTSDYV DHQLKSPDSI FWNSSEHSTS SSNTGTNSTD TQWVVDPGES RLPVESHPSE  180
YNVRPLVQSN SERSRGSLNN FNNSNAHVDS LVNPNVVSNV FTDSESILQF KRGMEEASKF  240
LPNLSQFVID LDNYTLPPKM EEVSKEAVVK VEKDEKNHSP NGTKGRKHQY PEDSDYEDER  300
SNKQSAIYVE EVELSEMFDR VLLCTDKGTG CGDVKCEMPS EVNKSSDQNG QAHGSNGGKT  360
RAKKQGTKNE AVDLRTLLIS CAQSVAADDR RTANEQLKQI RQHSSPTGDA YQRLASVFAD  420
GLEARLAGTG TQQYAALAPK RITAAEKLKA YQVYLSSCPF KKISILFANK MIFHTASNAR  480
TLHLIDFGIT YGFQWPILIQ LLSQIPSGPP KLRITGIDLP QPGFRPAESL EQTGSRLAKY  540
CERFHVPFEY NAIATQNWEN IKIEDLKLAS GETVAVNCLF RLKNLLDETV VVDSPRDAVL  600
SLIRKMNPDI FVQAVVNGSY SAPFFVTRFR EALFHYSTLF DMFDATLPRD DQQRLHFEQE  660
FYRREAMNVI ACEGSERVER PETYKQWQVR NMRAGFKLLP LNQQLMQKLR CKVKGGYHRD  720
FVFDEDGNWM LQGWKGRVVC ASSCWVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-413787028329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606498.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_016485888.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLK4C9Y80.0K4C9Y8_SOLLC; Uncharacterized protein
STRINGSolyc06g076280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14