PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 521aa    MW: 58138.1 Da    PI: 6.7125
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS457.48.7e-1401515211374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     ++++L++cA+avs+gdl  aq l+a+l++++s +g+p+qRl ay++e+L arla s+s+++k+l+++e +   s e l+++++++e++P++kf++
  XP_009605527.1 151 MKHVLIACAKAVSDGDLLTAQVLIAELRQMVSVSGEPIQRLGAYILEGLVARLAASGSSICKSLRCKEPA---SFELLSYMHMLYEICPYFKFGY 242
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN aI ea++ e+rvHiiDf+i qG QW++L+qa+a+Rp+gpp++R+Tg+++++s   +   l+ +g+rL+k+A++++vpfef++ +a + +d
  XP_009605527.1 243 MSANGAIAEAMKDENRVHIIDFQIAQGSQWVTLIQAFAARPGGPPHIRVTGIDDSTSAyaRGGGLNIVGQRLSKLAKAFKVPFEFHA-AAISGSD 336
                     ******************************************************998899999************************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L ++pgEalaVn+++ lh+++desvs+e++rd++L++vk+l+Pkvv++veqe+++n++ F+ rfle+l+yy+a+f+s++++lpr ++eri
  XP_009605527.1 337 VQVENLGIQPGEALAVNFAFTLHHMPDESVSTENHRDRLLRMVKNLNPKVVTLVEQESNTNTAAFFPRFLETLDYYTAMFESIDMTLPRGHKERI 431
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+r++vn++aceg er+erhe l+kW++r+++aGF+p+pls+ +++++k+ll+ +++  yr+ee++g+l+lgW++r Lv+ +aW+
  XP_009605527.1 432 NVEQHCLARDVVNIIACEGIERVERHELLGKWKSRFRMAGFSPYPLSSLVNATIKRLLESYSD-KYRLEERDGALYLGWMNRDLVASCAWK 521
                     **************************************************************5.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098571.073125502IPR005202Transcription factor GRAS
PfamPF035143.0E-137151521IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MQASRRLRRS SMSNTLYYQP VQKAEAYCLP QFQTLDNHLS YINGSHGVYH SPSTASFSSN  60
GSSICHQESQ PYLSDVCQSS EMTNYGSPSS GSCITDGVND FMHKLKELES VMLGPDSDFL  120
ESYDNSLPSS IASTEINSWR QMMEAIPRRD MKHVLIACAK AVSDGDLLTA QVLIAELRQM  180
VSVSGEPIQR LGAYILEGLV ARLAASGSSI CKSLRCKEPA SFELLSYMHM LYEICPYFKF  240
GYMSANGAIA EAMKDENRVH IIDFQIAQGS QWVTLIQAFA ARPGGPPHIR VTGIDDSTSA  300
YARGGGLNIV GQRLSKLAKA FKVPFEFHAA AISGSDVQVE NLGIQPGEAL AVNFAFTLHH  360
MPDESVSTEN HRDRLLRMVK NLNPKVVTLV EQESNTNTAA FFPRFLETLD YYTAMFESID  420
MTLPRGHKER INVEQHCLAR DVVNIIACEG IERVERHELL GKWKSRFRMA GFSPYPLSSL  480
VNATIKRLLE SYSDKYRLEE RDGALYLGWM NRDLVASCAW K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-601555218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
GenBankBT0145720.0BT014572.1 Lycopersicon esculentum clone 134027R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605526.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009605527.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009605528.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0V0IJG70.0A0A0V0IJG7_SOLCH; Putative scarecrow-like transcription factor PAT1-like
STRINGSolyc07g047950.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein