PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 335aa    MW: 38180.1 Da    PI: 5.8049
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603649.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix28.25e-091885269
        trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69
                    Wt +e l+L++  ++++ + +++ +  ++W++  +++ + g++rs +qCk +we +   y k+k +e 
  XP_009603649.1 18 WTLHESLTLVNEMKSTQIECGNTLASFQKWQSTVQNCNSLGVNRSLNQCKRRWEFMLENYNKVKPWET 85
                    ****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138374.9E-81784No hitNo description
PROSITE profilePS500906.41874IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEKSGGSLRT RSQVAPDWTL HESLTLVNEM KSTQIECGNT LASFQKWQST VQNCNSLGVN  60
RSLNQCKRRW EFMLENYNKV KPWETAYWTT SFDRDRKSEL GLPEDFDFEL FSAIGRYLSL  120
LQGEDGGGAE TDPDSDPEAQ QAQGNNSFLE IGLKRQRQRT KPRKFKMEER LNPWRRILNE  180
NRKYEQSMVG IKHEASVDAK LEAPGHEKSS LPIKRETSSP EEKVELPSLS LVNTVKAEQI  240
NVDNPEEMMA ATLRESAELI TAIIEGSPMD DRDCRLADLK NFEAGRVHLI RSQGNQLIEC  300
LGKISDTLSQ LCDSIHKKIT NFNSLAFSIM VRFVM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153158KRQRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603649.10.0PREDICTED: uncharacterized protein LOC104098583 isoform X1
TrEMBLA0A1S3YP060.0A0A1S3YP06_TOBAC; trihelix transcription factor ASR3-like
STRINGXP_009603649.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-49sequence-specific DNA binding transcription factors