PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 530aa    MW: 58911.2 Da    PI: 6.6964
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603492.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS383.91.9e-1171575291374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal..ppsetseknsseelaalklfsevsPilk 92 
                     lv+lL++cAeav+ +d+++a+ lL++l+  a   g+++qR+a++f+++La rla  +  +++  +  p+ +++++  +++  al+l++e++P ++
  XP_009603492.1 157 LVQLLITCAEAVACRDKSRASVLLSELRASALVFGTSFQRVASCFVQGLADRLALvQPLGTVGYVatPAMNKTDMVLEKKEEALRLLYEICPHIQ 251
                     689**************************************************9833334444441144444444488899999*********** PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                     f+h++aN  Ilea+ege+ +H++D+++s    +G QW  L+q+La+Rp++pp +lRiT+vg+    + e+++ +g+ L+ +A++lg+++ef++ v
  XP_009603492.1 252 FGHFVANCSILEAFEGESFIHVVDLGMSlglpHGHQWRRLIQSLANRPGQPPrRLRITAVGQ----NIEKVQIIGDELEAYARSLGINLEFSA-V 341
                     ************************99874444678*************877779********....99*************************.7 PP

            GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                     +++le+l++++++v  gE+l+Vn++lqlh +++es    +   +vL++v +lsPk++v+veq+++hn++ Fl rf+eal+yysa+fdsl++ lp+
  XP_009603492.1 342 ESNLENLKPKDIKVYDGEVLVVNSILQLHCVVKESRGALN---SVLQVVHELSPKILVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDVMLPK 433
                     9*******************************88877777...8*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvS 371
                      + +r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+++p++  +++qak  l+kv+  +g+++ ee+g+lvlgWk++p+v++S
  XP_009603492.1 434 YDTKRAKIEQFYFAEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQAAPIK--MVSQAKQWLAKVNaYEGFTITEEKGCLVLGWKSKPIVAAS 526
                     ***************************************************96..79************************************** PP

            GRAS 372 aWr 374
                     +W+
  XP_009603492.1 527 CWK 529
                     **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.673131510IPR005202Transcription factor GRAS
PfamPF035146.7E-115157529IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MTYDMVTGFL SLEPCNNDQI GYDPLENGLY LSHKELAYSL NPYTAGFKRN AASMFSSLSN  60
ESGDFKRLRR TPSLGESLGS NSNSFYSDSS SSSSGGGGSI PRTDSTNSVN SLQLAPRLHF  120
RDHVWALNQR YLAAEAIEEA AADIISQEEE NGEGMKLVQL LITCAEAVAC RDKSRASVLL  180
SELRASALVF GTSFQRVASC FVQGLADRLA LVQPLGTVGY VATPAMNKTD MVLEKKEEAL  240
RLLYEICPHI QFGHFVANCS ILEAFEGESF IHVVDLGMSL GLPHGHQWRR LIQSLANRPG  300
QPPRRLRITA VGQNIEKVQI IGDELEAYAR SLGINLEFSA VESNLENLKP KDIKVYDGEV  360
LVVNSILQLH CVVKESRGAL NSVLQVVHEL SPKILVLVEQ DSSHNGPFFL GRFMEALHYY  420
SAIFDSLDVM LPKYDTKRAK IEQFYFAEEI KNIVSCEGPA RVERHERVDQ WRRRMSRAGF  480
QAAPIKMVSQ AKQWLAKVNA YEGFTITEEK GCLVLGWKSK PIVAASCWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-501575294375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603492.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016441386.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1B8B10.0M1B8B1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000394550.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81672130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.13e-80GRAS family protein