PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 492aa    MW: 55677.9 Da    PI: 8.7159
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603019.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.11.1e-108994861373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA++ ssg+l+ a+a+L+++ +las +gd+mqRlaa f+  La rl++ +++ly+al+ +   +++ ++   ++ +f +++P+l f++
  XP_009603019.1  99 LIQLLFTCANHASSGNLHHADACLSQILQLASITGDSMQRLAAWFASSLAIRLVKRWPGLYNALNHRGPVPRRIVDLDRSRIIFAKAFPYLGFAY 193
                     689*******************************************************************9999999999999************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      + N+ + +a+++++ +Hi+D++ +    W+++l++  + p+g+p+l+iT v++    +k +lee+++r++k A++l+++f+fn l   +l +l+
  XP_009603019.1 194 AVINRVLIQAMSEDRIIHIVDLGSGDTKLWIPFLKTVVNLPNGTPHLKITCVNN----NKAMLEEMASRIKKEAKALDISFQFNSL-NVNLRELT 283
                     ******************************************************....9**************************5.889***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                     l++L+vk gE+la  +vl+lh ll                 +++v+  ++ +e+L ++ slsPkv+++veqeadhn +++++rf+e l+yysalf
  XP_009603019.1 284 LDMLKVKAGESLAFVSVLNLHVLLaeddrinshfslnknnnNNNVKDCKRMSEFLTMLHSLSPKVLILVEQEADHNLSKLVDRFVEGLHYYSALF 378
                     **************************************98877777777999******************************************* PP

            GRAS 269 dsleaklpres....eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                     ds+++++   +    eer+ vE++ lg+ei+n+vaceg er+erhe+++kW  rl++ GF+pv+l ++++++ak+l++ ++ dgy++ +++gsl+
  XP_009603019.1 379 DSIDTTFKGSNcslcEERVAVEQM-LGKEIENMVACEGLEREERHERFGKWIVRLTRGGFRPVRLWYDIMEDAKRLVEAYGRDGYKIISQKGSLM 472
                     ******998889999*********.********************************************************************** PP

            GRAS 360 lgWkdrpLvsvSaW 373
                     ++W+drp++svSaW
  XP_009603019.1 473 ICWHDRPIYSVSAW 486
                     ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.07273467IPR005202Transcription factor GRAS
PfamPF035143.8E-10699486IPR005202Transcription factor GRAS
Gene3DG3DSA:3.40.50.1506.2E-5195276IPR029063S-adenosyl-L-methionine-dependent methyltransferase
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MSFLYCTIWL LPPVQKLAFR PTHLLHIILL IESDIYNAPF KILILILNIG CKKFIMNISS  60
PAIKPDVTLS LTLSSFTSTT TTTDTSPDAL KPKEGGVKLI QLLFTCANHA SSGNLHHADA  120
CLSQILQLAS ITGDSMQRLA AWFASSLAIR LVKRWPGLYN ALNHRGPVPR RIVDLDRSRI  180
IFAKAFPYLG FAYAVINRVL IQAMSEDRII HIVDLGSGDT KLWIPFLKTV VNLPNGTPHL  240
KITCVNNNKA MLEEMASRIK KEAKALDISF QFNSLNVNLR ELTLDMLKVK AGESLAFVSV  300
LNLHVLLAED DRINSHFSLN KNNNNNNVKD CKRMSEFLTM LHSLSPKVLI LVEQEADHNL  360
SKLVDRFVEG LHYYSALFDS IDTTFKGSNC SLCEERVAVE QMLGKEIENM VACEGLEREE  420
RHERFGKWIV RLTRGGFRPV RLWYDIMEDA KRLVEAYGRD GYKIISQKGS LMICWHDRPI  480
YSVSAWNCAF IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-31994864374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0126390.0AB012639.1 Nicotiana sylvestris Lhcb1*7 gene for light harvesting chlorophyll a/b-binding protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603019.10.0PREDICTED: scarecrow-like protein 3
TrEMBLA0A0D2M1880.0A0A0D2M188_G
STRINGPOPTR_0004s21850.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA135701216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-110scarecrow-like 3