PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602534.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 543aa    MW: 62705.8 Da    PI: 5.7664
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602534.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.41.6e-941545281374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsPilkf 93 
                     lve Ll+cAe v++++  +a +lL++  +l+s++g+p+qRl+ yf +AL++r+ +  +++  k+l+    ++ +   ++++  ++ ++  P+ ++
  XP_009602534.1 154 LVECLLSCAEKVEQKQYDRAIKLLNECDKLSSKTGNPVQRLVYYFSRALRERVDKeIGKNSTKSLEIYGMRDLQeALRSINQCTIAVQDMPLCQV 248
                     5789***************************************************8888899999888888655355666666669999****** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egpp..slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       ++  qaI+e v +++++HiiD++i++G+QW  L+qaL + +  +++p   l+iT++g+ +  s+ +leetg+rL +fAe+l++ f f+ ++++
  XP_009602534.1 249 IKFAGIQAIVENVRNSKKIHIIDLEIKMGVQWTILIQALVTHQqeSQSPfeYLKITALGNTQ--SRIKLEETGKRLMRFAESLNLLFYFKSVITE 341
                     ****************************************887664455458********55..******************************* PP

            GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                     ++ dl+ e+L+++p+E++aV  ++ l ++  ++   e+  d +++++k+++P+v+v++e ea+hns+ F++rf+eal y+ a+fd +e  + +++
  XP_009602534.1 342 DILDLKKEDLDIDPEETIAVYAQHFLTNMIMKQ---EK-LDFLMRFIKGINPRVMVIAEVEANHNSPIFVNRFIEALFYHGAFFDLFEDCMKNNE 432
                     *****************************9444...44.666***************************************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     ++r+++E e++ + i+n+va+eg+er+ rh t e Wre ++++G+++++ls++   qak++l+k++ ++ +++e + + lv+gWk+ pL+s+SaW
  XP_009602534.1 433 SNRTTMESEFMWQGIRNIVAAEGEERTIRHVTIELWREYFKRFGMEEMKLSNSSLYQAKMVLEKFStGNSFTLEMNGNFLVIGWKKTPLISLSAW 527
                     ******************************************************************9999************************* PP

            GRAS 374 r 374
                     +
  XP_009602534.1 528 K 528
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.781128507IPR005202Transcription factor GRAS
PfamPF035145.7E-92154528IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MEPAQEISWF STGIVLNQED EEDITSKKEL PSNANFVTFD DWYFDVENET KNDLYVTPES  60
LIHNKKERAS LISSLNILKD FGNGFRKLKG QKITIQTSEI ECANDGKLST DAILRLGGQN  120
FIQSFESSVS SSVDHPFVSS LLSLSEKDSR NVELVECLLS CAEKVEQKQY DRAIKLLNEC  180
DKLSSKTGNP VQRLVYYFSR ALRERVDKEI GKNSTKSLEI YGMRDLQEAL RSINQCTIAV  240
QDMPLCQVIK FAGIQAIVEN VRNSKKIHII DLEIKMGVQW TILIQALVTH QQESQSPFEY  300
LKITALGNTQ SRIKLEETGK RLMRFAESLN LLFYFKSVIT EDILDLKKED LDIDPEETIA  360
VYAQHFLTNM IMKQEKLDFL MRFIKGINPR VMVIAEVEAN HNSPIFVNRF IEALFYHGAF  420
FDLFEDCMKN NESNRTTMES EFMWQGIRNI VAAEGEERTI RHVTIELWRE YFKRFGMEEM  480
KLSNSSLYQA KMVLEKFSTG NSFTLEMNGN FLVIGWKKTP LISLSAWKFR KRSNSHGTYF  540
FTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-411515281375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602534.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1A0F90.0M1A0F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000119540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-56RGA-like 2