PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 380aa    MW: 43260.3 Da    PI: 6.3298
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.31.2e-2475156286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++aLi +rre+++ ++++k++k+lW+++s kmre+gf rsp++C++kw+nl k++kk k++++    + s +++y +++e
  XP_009599397.1  75 WVQEETRALISLRRELDSLFNTSKSNKHLWDQISLKMREKGFDRSPTMCTDKWRNLLKEFKKAKHNQEP---NGSAKMSYHKEIE 156
                     ****************************************************************99886...5667888988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-466133IPR009057Homeodomain-like
PROSITE profilePS500908.71167131IPR017877Myb-like domain
SMARTSM007176.8E-671133IPR001005SANT/Myb domain
CDDcd122031.48E-2873138No hitNo description
PfamPF138372.6E-1974158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MSDKLPTSIN LYEEQESMDQ HSNHMIIEVA APNAHLQQPQ QILLPGISGG DTTSSGGEDN  60
NNNVKLAPKK RAETWVQEET RALISLRREL DSLFNTSKSN KHLWDQISLK MREKGFDRSP  120
TMCTDKWRNL LKEFKKAKHN QEPNGSAKMS YHKEIEEILK ARNKNYKNPT LKVDTFMQFS  180
QKGLDDTSIT FGPVEENGRP TLNLERQLDH DGHPLAITAA DAVTASGSPW NWRETPGNGE  240
QSNSAEGRVI SVKWGDYTKR IGIDGTADAI KQAIKSAFRL RTERAFWLED EQNIVRALDR  300
DMPLGSYSLH VDEGLTIKVC MYEEADHSSV HTEDKTFYTA NDFRDFLSHR GWTCLREYNG  360
YRHVDMLDEL CPGAVYRGVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-4569154186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00640PBMTransfer from MDP0000164819Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankS469420.0S46942.1 Box II Factor [tobacco, mRNA Partial, 1506 nt].
GenBankTOBB2F0.0M96432.1 Nicotiana tabacum DNA-binding protein (B2F) gene, 3' end.
GenBankTOBGT1A0.0M93436.2 Nicotiana tabacum DNA-binding protein (GT-1a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599397.10.0PREDICTED: trihelix transcription factor GT-4 isoform X1
SwissprotQ9FX531e-160TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLQ433260.0Q43326_TOBAC; Box II Factor (Fragment)
TrEMBLQ7DMS90.0Q7DMS9_TOBAC; DNA-binding protein
STRINGXP_009599397.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51132136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-160Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]