PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594671.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 583aa    MW: 65002.5 Da    PI: 7.0126
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594671.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.52.1e-1302135821373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+a+++++l    +l+a+ ++ +s +gdp+qRl ay++e+L ar   s++++y+al+++e +     + l+++++++e++P+lkf++
  XP_009594671.1 213 LKQLLIACARALAENKLDDFGSLIAKARNAVSITGDPIQRLGAYIVEGLVARKEASGTNIYRALRCKEPA---GRDLLSYMQILYEICPYLKFGY 304
                     689******************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + l  +gerLa++ +++++p+ef++ v     +
  XP_009594671.1 305 MAANGAIAEACRNEDRIHIIDFQIAQGTQWLTLLQALAARPSGAPHVRITGIDDPVSKyaRGDGLTLVGERLAEVSKKFNIPVEFHA-VPVFAPE 398
                     *******************************************************999999**************************.6888999 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ ++L+v+pgEalaVn+ l lh+++desv+++++rde+L++vkslsPkvv++veqe+++n+++F+ rfleal+yy a+f+s++++l r+ +eri
  XP_009594671.1 399 VTRDMLDVRPGEALAVNFPLVLHHTPDESVDVTNPRDELLRMVKSLSPKVVTLVEQESNTNTAPFFPRFLEALDYYCAMFESIDVTLERDRKERI 493
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     +vE+++l+r+ivn++aceg+er+erhe l+kW+ r+++aGF+++pls+++++ +k+llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  XP_009594671.1 494 NVEQHCLARDIVNIIACEGKERVERHELLGKWKLRFTMAGFRQYPLSSYVNSVIKSLLRCYS-EHYTLVEKDGAMLLGWKDRNLISASAW 582
                     **********************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.857187564IPR005202Transcription factor GRAS
PfamPF035147.2E-128213582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MESHHLYGYG VTGANLSYSY SKATTPSLPN RLLGTLKFDS RNSPNSPFAN YFDPDTPTTL  60
SDSLEQHSST ENISGTSPSS NSSLDYNHYF HRPSPSPNFR PNTLLVRSGE TSLQQYANHS  120
QNMKHALLQL ETALMGPEEE ATTSSPSAGD IKQPQTSGQR SRMWNQEGQV SRRIETQPLH  180
VSAFGISSSG IQSEKRHKAM EDLSLQGIPS GNLKQLLIAC ARALAENKLD DFGSLIAKAR  240
NAVSITGDPI QRLGAYIVEG LVARKEASGT NIYRALRCKE PAGRDLLSYM QILYEICPYL  300
KFGYMAANGA IAEACRNEDR IHIIDFQIAQ GTQWLTLLQA LAARPSGAPH VRITGIDDPV  360
SKYARGDGLT LVGERLAEVS KKFNIPVEFH AVPVFAPEVT RDMLDVRPGE ALAVNFPLVL  420
HHTPDESVDV TNPRDELLRM VKSLSPKVVT LVEQESNTNT APFFPRFLEA LDYYCAMFES  480
IDVTLERDRK ERINVEQHCL ARDIVNIIAC EGKERVERHE LLGKWKLRFT MAGFRQYPLS  540
SYVNSVIKSL LRCYSEHYTL VEKDGAMLLG WKDRNLISAS AWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-642105831375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8780270.0EU878027.1 Capsicum annuum scarecrow-like protein (SCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594671.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLC6ZH460.0C6ZH46_CAPAN; Scarecrow-like protein
STRINGSolyc07g063940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-172GRAS family protein