PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 567aa    MW: 62338.4 Da    PI: 4.7171
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594460.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4585.9e-1401865581374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAeav++++l+ a+al+ ++  la ++  +m+++a+yf+eALa+r+++        + p+++ e++ +++l++   f+e++P+lkf+h
  XP_009594460.1 186 LVHTLMACAEAVQQENLNVADALVRHIGILAVSQSGAMRKVATYFAEALARRIYK--------IYPQDSIESSYTDVLQM--HFYETCPYLKFAH 270
                     689****************************************************........44666654445555544..4************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+ ++++vH+iDf+++qG+QWpaL+qaLa+Rp+gpp +R+Tg+g+p++g++++l+++g++La+fAe++gv+fef+ +v+++l+dl+
  XP_009594460.1 271 FTANQAILEAFTNCNKVHVIDFSLKQGMQWPALIQALATRPGGPPAFRLTGIGPPQPGNTDALQQVGWKLAQFAEAIGVEFEFRGFVTNSLADLD 365
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres... 279
                      e L++++    E++aVn+v++lhrll++++++e+    vL+ +k+++Pk+v++veqea+hn++ Fl+rf eal+yys++fdsle+++++ s   
  XP_009594460.1 366 AEILDLRSsteTEVVAVNSVFELHRLLARPGAVEK----VLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLESSVSTSStgl 456
                     ****99988899***********************....************************************************66666666 PP

            GRAS 280 ......eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpL 367
                           +++ ++++++lgr+i+nvvaceg +r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL
  XP_009594460.1 457 tqpivnNQDLVMSEVYLGRQICNVVACEGVDRVERHETLRQWRVRMNSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENDGCLMLGWHTRPL 551
                     6666669**************************************************************************************** PP

            GRAS 368 vsvSaWr 374
                     +++SaWr
  XP_009594460.1 552 IATSAWR 558
                     ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.6E-3332105No hitNo description
PfamPF120418.1E-343298IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098568.259160537IPR005202Transcription factor GRAS
PfamPF035142.0E-137186558IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MKRDRDREKS QDGSSSDKSK IFEEEQPDAG MDELLAVLGY KVKSSDLAEV AQQLEQLEMA  60
MCTILEDGIS HLSTDTVHKN PSDLSGWVQS MLSELNNTSV PSNFDMIGSI GEEDLCVSPG  120
GGASSSSITI NEQNRIISDD DLRAIPGGAV FSTESNKRQR SCFPLTADAI TRPVVLVDSQ  180
ETGVRLVHTL MACAEAVQQE NLNVADALVR HIGILAVSQS GAMRKVATYF AEALARRIYK  240
IYPQDSIESS YTDVLQMHFY ETCPYLKFAH FTANQAILEA FTNCNKVHVI DFSLKQGMQW  300
PALIQALATR PGGPPAFRLT GIGPPQPGNT DALQQVGWKL AQFAEAIGVE FEFRGFVTNS  360
LADLDAEILD LRSSTETEVV AVNSVFELHR LLARPGAVEK VLNSIKQMNP KIVTIVEQEA  420
NHNASVFLDR FNEALHYYST MFDSLESSVS TSSTGLTQPI VNNQDLVMSE VYLGRQICNV  480
VACEGVDRVE RHETLRQWRV RMNSAGFDPV HLGSNAFKQA SMLLALFAGG DGYRVEENDG  540
CLMLGWHTRP LIATSAWRFK AAGDAEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-551865584375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0821480.0KR082148.1 Nicotiana benthamiana GAI1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594460.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLM9N8J90.0M9N8J9_NICAT; ELLA domain GRAS family transcription factor
STRINGPGSC0003DMT4000405890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein