PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009594270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 544aa    MW: 60927.6 Da    PI: 6.1237
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009594270.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS429.33e-1311745441374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cAeav++ d + a+ l++ l+e++s +g+pmqRl ay++e+L+arl++s+s +yk+l+++e +   ss+ l++++++++++P++kf++
  XP_009594270.1 174 LKDLLFACAEAVAEADISSAEGLMNVLEERVSVSGEPMQRLSAYMLEGLRARLLSSGSIIYKKLKCNEPT---SSDLLSYMQVLYHICPYFKFAY 265
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN  I ea+ +e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp +R+Tgv++++s   +   l  +gerL+k+Ae++gvpfef+  +a +   
  XP_009594270.1 266 MSANVVIGEAMRNENRIHIIDFQIAQGSQWMFLLHDLARRPGGPPFVRVTGVDDSQSAhaRGGGLTLVGERLTKVAESCGVPFEFHG-AAMSGCR 359
                     ******************************************************9988889999***********************.89999** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +ele+L+v++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n+++Fl rf e+l+yy+a+f+s++a  pr++++ri
  XP_009594270.1 360 VELENLQVRHGEALAVNFPYMLHHMPDESVSTMNHRDRLLRLVKSLSPKIVTLVEQESNTNTAPFLPRFRETLDYYTAMFESIDAARPRDDKQRI 454
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r+ivn++acegaer+erhe ++kWr+rl +aGF+p pls ++ +++k +l++++ + y++ e +++l+lgWk+r+L + SaWr
  XP_009594270.1 455 SAEEHCVARDIVNIIACEGAERVERHEPFGKWRSRLVMAGFTPFPLSPSVGETIKDMLKEYSPN-YKLAECQEALYLGWKNRALATSSAWR 544
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.524148525IPR005202Transcription factor GRAS
PfamPF035141.0E-128174544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MYASQRPQRS GSVHSLNQQP MQQVQQYYTP YRAFDNSIYN DSSSSGTQFS FQTQNEQFFT  60
LDSLPATDYT VYDADPSVSI SSNRSPFSPQ CSQSYMSDPH HSYDNTCGSP VSWCSGVDDG  120
NGTKHVLREL KNKLLGPDSD IDDSSSCSFN GVISKPSSLI KWNQVLDIAS RLDLKDLLFA  180
CAEAVAEADI SSAEGLMNVL EERVSVSGEP MQRLSAYMLE GLRARLLSSG SIIYKKLKCN  240
EPTSSDLLSY MQVLYHICPY FKFAYMSANV VIGEAMRNEN RIHIIDFQIA QGSQWMFLLH  300
DLARRPGGPP FVRVTGVDDS QSAHARGGGL TLVGERLTKV AESCGVPFEF HGAAMSGCRV  360
ELENLQVRHG EALAVNFPYM LHHMPDESVS TMNHRDRLLR LVKSLSPKIV TLVEQESNTN  420
TAPFLPRFRE TLDYYTAMFE SIDAARPRDD KQRISAEEHC VARDIVNIIA CEGAERVERH  480
EPFGKWRSRL VMAGFTPFPL SPSVGETIKD MLKEYSPNYK LAECQEALYL GWKNRALATS  540
SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-531785448375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009594270.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016460679.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLM1B1890.0M1B189_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000347630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13