PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009593291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 471aa    MW: 53215 Da    PI: 6.3074
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009593291.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS471.25.6e-144474681374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++vssg++e+a+ +L ++s+lasp+gd+mqR+a+yfteALa r++rs++++ykal++++ s   +se + ++k+f+e +P+lk+++
  XP_009593291.1  47 LIHLLLACANHVSSGSFENANIALDHISQLASPNGDTMQRIASYFTEALADRILRSWPGIYKALRSTKLS--VVSEDILVRKMFFEFFPFLKVAF 139
                     689*************************************************************999998..69********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +++Nq I ea+ege++vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae+l++pf+fn  v+++ledl+
  XP_009593291.1 140 VVTNQSIIEAMEGEKMVHIVDLNVSEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTEEAEKLDIPFQFNQ-VVSQLEDLD 229
                     ******************************************************....9**************************.799****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll.......................................................desvsleserdevLkl 230
                     +e+Lr+k+gEala+++v+qlh+l+                                                       + +++++ + d +L++
  XP_009593291.1 230 VEKLRIKTGEALAISSVMQLHTLFahdnepqkksplpfkhsngvnlhkalinqntlgellekdmghiangyspsndtasSPPLCSTTKMDGFLNA 324
                     **************************************************************************99966555556668999**** PP

            GRAS 231 vkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                     +++lsPkvvvv+eq+++hn+ +++er++e+l+yy+alfd+le  lpr+s er kvE++llg+ei+nv++ceg er+erhe+lekW +r++ aGF+
  XP_009593291.1 325 LWGLSPKVVVVTEQDSNHNGITLMERLSESLHYYAALFDCLEFALPRTSLERLKVEKMLLGEEIKNVISCEGIERKERHEKLEKWFQRFDVAGFG 419
                     *********************************************************************************************** PP

            GRAS 326 pvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vpls++a+ qa++ll+ ++ +gy+++ee+g++v++W+dr+L+svS+Wr
  XP_009593291.1 420 NVPLSYYAMLQARRLLQSYSCEGYKIKEENGCVVICWHDRALFSVSSWR 468
                     ************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.02821448IPR005202Transcription factor GRAS
PfamPF035141.9E-14147468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLQIFP MMSLSPGFSS SNQWLKELKS EERGLYLIHL LLACANHVSS  60
GSFENANIAL DHISQLASPN GDTMQRIASY FTEALADRIL RSWPGIYKAL RSTKLSVVSE  120
DILVRKMFFE FFPFLKVAFV VTNQSIIEAM EGEKMVHIVD LNVSEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTEEAE KLDIPFQFNQ VVSQLEDLDV EKLRIKTGEA  240
LAISSVMQLH TLFAHDNEPQ KKSPLPFKHS NGVNLHKALI NQNTLGELLE KDMGHIANGY  300
SPSNDTASSP PLCSTTKMDG FLNALWGLSP KVVVVTEQDS NHNGITLMER LSESLHYYAA  360
LFDCLEFALP RTSLERLKVE KMLLGEEIKN VISCEGIERK ERHEKLEKWF QRFDVAGFGN  420
VPLSYYAMLQ ARRLLQSYSC EGYKIKEENG CVVICWHDRA LFSVSSWRCR K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-38474684375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009593291.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM1A0990.0M1A099_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3