PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 669aa    MW: 75003.9 Da    PI: 6.818
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592767.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.4e-24129229198
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv++++L +gD++vF +    ++
  XP_009592767.1 129 FCKVLTASDTSTHGGFSVLRKHANEClppldMNQQTPTQELIAKDLHGTEWHFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDSFVFLR--GGNG 221
                     99****************************9555555679************************************************4..3788 PP

                     ..EEEEE- CS
              B3  91 elvvkvfr 98 
                     el+v+v+r
  XP_009592767.1 222 ELRVGVRR 229
                     99****98 PP

2Auxin_resp99.54.5e-33255334183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr+  s+F++ ++k+++++k+ +svGmRfkm+fe+e+s+err++Gt+vg++dl++ +W++S WrsLk
  XP_009592767.1 255 ASHAVTTQTLFVVYYKPRT--SQFIIGLNKYLETVKHGYSVGMRFKMQFEGEESPERRFTGTIVGIEDLSS-QWKDSTWRSLK 334
                     689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.63E-41120258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-43122244IPR015300DNA-binding pseudobarrel domain
CDDcd100176.94E-22127229No hitNo description
PROSITE profilePS5086312.464129231IPR003340B3 DNA binding domain
SMARTSM010191.6E-22129231IPR003340B3 DNA binding domain
PfamPF023622.5E-22129229IPR003340B3 DNA binding domain
PfamPF065073.3E-31255334IPR010525Auxin response factor
PfamPF023091.0E-11555648IPR033389AUX/IAA domain
SuperFamilySSF542772.16E-11558640No hitNo description
PROSITE profilePS5174521.472564645IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MENNGCYQSQ QQTNFSVKGK DDLYQELWKL CAGPLVDVPK YGERVYYFPQ GHMEQLEASM  60
NQELNLRIPS FNLKPKILCR VIHTQLLAEQ DTDEVYAQIT LMPEAAEQAE PTSQDPCPPE  120
PQRPKVHSFC KVLTASDTST HGGFSVLRKH ANECLPPLDM NQQTPTQELI AKDLHGTEWH  180
FKHIFRGQPR RHLLTTGWST FVSSKRLVAG DSFVFLRGGN GELRVGVRRL ARQQSSMPSS  240
VISSQSMHLG VLATASHAVT TQTLFVVYYK PRTSQFIIGL NKYLETVKHG YSVGMRFKMQ  300
FEGEESPERR FTGTIVGIED LSSQWKDSTW RSLKVQWDEP ASISRPDRVS PWEIEPFVVS  360
VPNPLVPPMA GKNKRHRPHS EAKISEPASS IASAVWNPST DSPQFNTTGI NSSTNCMLTS  420
HTDSLCGWRL PHLHTSSSML VDETEDTKSA SAWSGFPSVL SSQFSKGTNQ PILSPTDERK  480
CDTITTCRLF GIDLKSTLIS TTEAPLPKPA NISNVSAERA SPNTVPAFDS DQNSDLSIDF  540
KDQKQGQLQL LLKEVQSKQN CSTRSRTKVQ MQGVAVGRAV DLTALKGYNE LIKELEEMFE  600
IQGELHPRNK WEMVFTDDEG DMMLMGDHPW LEFCNVVRRI FIVSSQDMKK WSAGNKVLSC  660
AADNEAIAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1752135717355Auxin response factor 1
4ldw_A1e-1752135717355Auxin response factor 1
4ldw_B1e-1752135717355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592767.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1U7V9N80.0A0A1U7V9N8_NICSY; Auxin response factor
STRINGXP_009592767.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9